protein

Recombinant Toll Like Receptor 4 (TLR4)

MBS2009564

0.01 mg

160 USD

Recombinant Protein

Recombinant Toll Like Receptor 4 (TLR4)

Toll Like Receptor 4 (TLR4)

toll-like receptor 4; Toll-like receptor 4; toll-like receptor 4; lipopolysaccharide response; toll-like receptor 4

TLR4

Tlr4; Tlr4; Lps; Ly87; Ran/M1; Rasl2-8; Lps

TLR4_MOUSE

E Coli

835

VVPNITYQCM DQKLSKVPDD IPSSTKNIDL SFNPLKILKS YSFSNFSELQ WLDLSRCEIE TIEDKAWHGL HHLSNLILTG NPIQSFSPGS FSGLTSLENL VAVETKLASL ESFPIGQLIT LKKLNVAHNF IHSCKLPAYF SNLTNLVHVD LSYNYIQTIT VNDLQFLREN PQVNLSLDMS LNPIDFIQDQ AFQGIKLHEL TLRGNFNSSN IMKTCLQNLA GLHVHRLILG EFKDERNLE
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTD
DDDKAMADIGSEF-NPCIE
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.

> 95%

Supplied as lyophilized form in 10mM PBS, pH7.4, containing 1mM DTT, 5% trehalose, 0.01% sarcosyl and preservative.

Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months. Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)

Organism: Mus musculus (Mouse). Expression System: Prokaryotic expression. Residues: Asn26~Glu269 (Accession # Q9QUK6) with two N-terminal Tags, His-tag and S-tag. Subcellular Location: Membrane; Single-pass type I membrane protein. Predicted isoelectric point: 5.7. Predicted Molecular Mass: 33.3kDa

Endotoxin Level: <1.0EU per 1ug (determined by the LAL method). Reconstitution: Reconstitute in ddH2O.

10946594

NP_067272.1

NM_021297.2

Q9QUK6

Activated TLR4 Signalling Pathway (926081); Activation Of IRF3/IRF7 Mediated By TBK1/IKK Epsilon Pathway (926067); Amoebiasis Pathway (167330); Amoebiasis Pathway (167191); Chagas Disease (American Trypanosomiasis) Pathway (147810); Chagas Disease (American Trypanosomiasis) Pathway (147795); HIF-1 Signaling Pathway (695223); Hepatitis B Pathway (694729); IKK Complex Recruitment Mediated By RIP1 Pathway (926068); Immune System Pathway (926012)

This gene belongs to the evolutionarily-conserved Toll-like receptor family, whose members are type-1 transmembrane proteins that are involved in innate immunity. Toll-like receptors are characterized by an extracellular leucine-rich repeat domain that functions in ligand recognition and an intracellular toll/interleukin-1 receptor-like domain that is crucial for signal transduction. The receptor encoded by this gene mediates the innate immune response to bacterial lipopolysaccharide, a major component of the outer membrane of Gram-negative bacteria, through synthesis of pro-inflammatory cytokines and chemokines. In addition, this protein can recognize other pathogens from Gram-negative and Gram-positive bacteria as well as viral components. Mice deficient in this gene display a number of immune response-related phenotypes including hyporesponsiveness to bacterial lipopolysaccharide and increased levels of respiratory syncytial virus compared to controls. [provided by RefSeq, Sep 2015]

TLR4: Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS- independent inflammatory responses triggered by Ni(2+). These responses require non-conserved histidines and are, therefore, species-specific. Belongs to the lipopolysaccharide (LPS) receptor, a multi-protein complex containing at least CD14, LY96 and TLR4. Binding to bacterial LPS leads to homodimerization. Interacts with LY96 via the extracellular domain. Interacts with MYD88 and TIRAP via their respective TIR domains. Interacts with NOX4. Interacts with CNPY3. Interacts with HSP90B1. The interaction with both CNPY3 and HSP90B1 is required for proper folding in the endoplasmic reticulum. Highly expressed in placenta, spleen and peripheral blood leukocytes. Detected in monocytes, macrophages, dendritic cells and several types of T-cells. Belongs to the Toll-like receptor family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Receptor, misc.; Membrane protein, integral. Cellular Component: cell surface; membrane; perinuclear region of cytoplasm; integral to plasma membrane; cytoplasm; integral to membrane; plasma membrane; lipopolysaccharide receptor complex; lipid raft; external side of plasma membrane. Molecular Function: protein binding; transmembrane receptor activity; lipopolysaccharide binding; lipopolysaccharide receptor activity; phosphoinositide 3-kinase binding; receptor activity. Biological Process: positive regulation of nitric oxide biosynthetic process; positive regulation of apoptosis; activation of MAPK activity; leukotriene metabolic process; response to lipopolysaccharide; positive regulation of NF-kappaB import into nucleus; positive regulation of interleukin-10 production; activation of NF-kappaB transcription factor; positive regulation of B cell proliferation; positive regulation of interferon-beta production; negative regulation of interleukin-6 production; toll-like receptor 4 signaling pathway; positive regulation of interferon-alpha production; positive regulation of DNA binding; positive regulation of I-kappaB kinase/NF-kappaB cascade; production of nitric oxide during acute inflammatory response; positive regulation of interleukin-8 biosynthetic process; positive regulation of interleukin-6 production; positive regulation of tumor necrosis factor production; positive regulation of chemokine production; macrophage activation; negative regulation of interleukin-23 production; positive regulation of peptidyl-tyrosine phosphorylation; response to ethanol; response to bacterium; detection of lipopolysaccharide; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; response to oxidative stress; I-kappaB phosphorylation; activation of innate immune response; positive regulation of nitric-oxide synthase biosynthetic process; regulation of cytokine secretion; positive regulation of interleukin-12 production; positive regulation of interleukin-6 biosynthetic process; microglial cell activation; positive regulation of JNK cascade; signal transduction; defense response to Gram-negative bacterium; mast cell activation; positive regulation of interleukin-1 biosynthetic process; positive regulation of stress-activated MAPK cascade; positive regulation of interleukin-8 production; positive regulation of lymphocyte proliferation; positive regulation of interleukin-13 biosynthetic process; positive regulation of MHC class II biosynthetic process; negative regulation of interferon-gamma production; lipopolysaccharide-mediated signaling pathway; interferon-gamma production; inflammatory response; innate immune response-activating signal transduction; B cell proliferation during immune response; positive regulation of tumor necrosis factor biosynthetic process; immune system process; activation of NF-kappaB-inducing kinase; negative regulation of tumor necrosis factor production; MyD88-dependent toll-like receptor signaling pathway; positive regulation of interferon-gamma production; negative regulation of interleukin-17 production; positive regulation of interleukin-12 biosynthetic process; positive regulation of interferon-beta biosynthetic process; regulation of inflammatory response; toll-like receptor signaling pathway; innate immune response; immune response; regulation of sensory perception of pain; positive regulation of interleukin-1 production; positive regulation of inflammatory response

0.01 mg

160 USD

0.05 mg

320

0.1 mg

495