Biotin-Linked Antibody to Glucagon Like Peptide 1 (GLP1) | MyBioSource MBS2005134 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

Biotin-Linked Antibody to Glucagon Like Peptide 1 (GLP1)

catalog :

MBS2005134

quantity :

0.1 mg

price :

355 USD

clonality :

polyclonal

host :

rabbit

conjugate :

biotin

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, enzyme immunoassay

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS2005134

products type :

Antibody

products full name :

Biotin-Linked Antibody to Glucagon Like Peptide 1 (GLP1)

products short name :

Glucagon Like Peptide 1 (GLP1)

other names :

glucagon preproprotein; Glucagon; glucagon; preproglucagon; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide; glucagon; Incretin hormone

products gene name :

GLP1

other gene names :

GCG; GCG; GLP1; GLP2; GRPP; GRPP; OXM; OXY; GLP-1; GLP-1(7-37); GLP-1(7-36); GLP-2

uniprot entry name :

GLUC_HUMAN

clonality :

Polyclonal

isotype :

IgG

host :

Rabbit

reactivity :

Human

sequence length :

180

sequence :

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

specificity :

The antibody is a rabbit polyclonal antibody raised against GLP1. It has been selected for its ability to recognize GLP1 in immunohistochemical staining and western blotting.

purity :

Affinity Chromatography

form :

Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.

concentration :

100 ug/ml

storage stability :

Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

tested application :

Immunohistochemistry (IHC), ELISA (EIA), Western Blot (WB), Immunocytochemistry (ICC), Immunohistochemistry-P, Immunohistochemistry-F

app notes :

Western blotting: 1:100-400. Immunocytochemistry in formalin fixed cells: 1:100-500. Immunohistochemistry in formalin fixed frozen section: 1:100-500. Immunohistochemistry in paraffin section: 1:50-200. Enzyme-linked Immunosorbent Assay: 1:100-200. Optimal working dilutions must be determined by end user.

products categories :

Biotin Antibody

ncbi gi num :

4503945

ncbi acc num :

NP_002045.1

ncbi gb acc num :

NM_002054.4

uniprot acc num :

P01275

ncbi mol weight :

20,909 Da

ncbi pathways :

Class B/2 (Secretin Family Receptors) Pathway (106378); FOXA1 Transcription Factor Network Pathway (137979); G Alpha (q) Signalling Events Pathway (106043); G Alpha (s) Signalling Events Pathway (119549); GPCR Downstream Signaling Pathway (119548); GPCR Ligand Binding Pathway (161020); Gastrin-CREB Signalling Pathway Via PKC And MAPK (645295); Glucagon Signaling In Metabolic Regulation Pathway (106097); Glucagon-type Ligand Receptors Pathway (106380); Incretin Synthesis, Secretion, And Inactivation Pathway (187170)

ncbi summary :

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008]

uniprot summary :

GCG: Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion. Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain. Belongs to the glucagon family. Protein type: Secreted; Hormone; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 2q36-q37. Cellular Component: extracellular space; endoplasmic reticulum lumen; plasma membrane; extracellular region. Molecular Function: identical protein binding; protein binding; hormone activity; glucagon receptor binding; receptor binding. Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; response to starvation; cell proliferation; G-protein coupled receptor protein signaling pathway; cellular protein metabolic process; positive regulation of protein binding; positive regulation of protein kinase activity; positive regulation of cAMP biosynthetic process; energy reserve metabolic process; feeding behavior; positive regulation of histone H3-K4 methylation; signal transduction; regulation of insulin secretion; positive regulation of peptidyl-serine phosphorylation; negative regulation of apoptosis

size1 :

0.1 mg

price1 :

355 USD

more info or order :

MyBioSource product webpage