product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Full-Length Human Retinoblastoma Protein (p110RB)
catalog :
MBS197026
quantity :
0.035 mg
price :
370 USD
more info or order :
product information
catalog number :
MBS197026
products type :
Recombinant Protein
products full name :
Full-Length Human Retinoblastoma Protein (p110RB)
products short name :
Retinoblastoma Protein (p110RB)
products name syn :
Full-length Human Rb Protein; p110RB
host :
Genetically engineered E Coli
sequence :
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGP
EDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTW
EKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTF
TEL
specificity :
Full-length Rb Protein [Full-length RB Protein produced in E. coli; biologically active.]
purity :
>90%
concentration :
1.3 mg/ml.
storage stability :
This product is stable for at least six (6) ug months at -70 degree C or below. Ship in dry ice.
other info1 :
Activity Assay: [3H]-Thymidine incorporation anti-proliferation bioassay.
other info2 :
Biologically Active: Yes. Diluent: 20 mM sodium phosphate. 200 mM sodium chloride. 1 mM EDTA. 10% glycerol. pH 7.5. Sterile-filtered. Preservatives: None.
products categories :
Retinoblastoma Protein Products
ncbi mol weight :
110,000 daltons
size1 :
0.035 mg
price1 :
370 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!