Anti-TSG6 Antibody | MyBioSource MBS178683 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

Anti-TSG6 Antibody

catalog :

MBS178683

quantity :

0.1 mg

price :

280 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot

more info or order :

MyBioSource product webpage

image

image 1 :

Western blot analysis of TSG6 expression in rat brain extract (lane 1) and HELA whole cell lysates (lane 2). TSG6 at 31KD was detected using rabbit anti- TSG6 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

product information

catalog number :

MBS178683

products type :

Antibody

products full name :

Anti-TSG6 Antibody

products short name :

[TSG6]

products name syn :

[TNFAIP 6; Tnfaip6; TSG 6; TSG-6; P98066; Tumor necrosis factor-inducible gene 6 protein; TNF alpha induced protein 6]

other names :

[tumor necrosis factor-inducible gene 6 protein; Tumor necrosis factor-inducible gene 6 protein; tumor necrosis factor-inducible gene 6 protein; TNF alpha induced protein 6; Hyaluronate-binding protein; TNF-stimulated gene 6 protein; TSG-6; Tumor necrosis factor alpha-induced protein 6; TNF alpha-induced protein 6]

products gene name :

[TNFAIP6]

other gene names :

[TNFAIP6; TNFAIP6; TSG6; TSG-6; TSG6; TSG-6; TNF alpha-induced protein 6]

clonality :

Polyclonal

isotype :

IgG

host :

Rabbit

reactivity :

Human, Rat

sequence length :

277

specificity :

No cross reactivity with other proteins.

purity :

Immunogen affinity purified.

form :

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

storage stability :

Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

tested application :

Western Blot (WB)

app notes :

Western Blot. Concentration : 0.1-0.5 ug/ml. Tested Species: Human, Rat. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

image1 heading :

Western Blot (WB)

other info2 :

different from the related mouse sequence by two amino acids.
KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAA
GWMAKGR),
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml. Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa

products description :

Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.

products references :

1. "Entrez Gene: TNFAIP6 tumor necrosis factor, alpha-induced protein 6". 2. Lee TH, Klampfer L, Shows TB, Vilcek J (March 1993). "Transcriptional regulation of TSG6, a tumor necrosis factor- and interleukin-1-inducible primary response gene coding for a secreted hyaluronan-binding protein". J. Biol. Chem. 268 (9): 6154-60. 3. Milner CM, Day AJ (2004). "TSG-6: a multifunctional protein associated with inflammation.". J. Cell. Sci. 116 (Pt 10): 1863-73.

ncbi gi num :

26051243

ncbi acc num :

NP_009046.2

ncbi gb acc num :

NM_007115.3

uniprot acc num :

P98066

ncbi pathways :

Immune System Pathway (1269170); Innate Immune System Pathway (1269203); Neutrophil Degranulation Pathway (1457780)

ncbi summary :

The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.[provided by RefSeq, Dec 2010]

uniprot summary :

TNFAIP6: Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis. Chromosomal Location of Human Ortholog: 2q23.3. Molecular Function: protein binding. Biological Process: cell-cell signaling; inflammatory response; negative regulation of inflammatory response; signal transduction

size1 :

0.1 mg

price1 :

280 USD

more info or order :

MyBioSource product webpage