antibody

Anti-TECTA Antibody

MBS178671

0.1 mg

315 USD

polyclonal

rabbit

nonconjugated

human, mouse, rat

western blot, immunohistochemistry, immunohistochemistry - paraffin section

Antibody

Anti-TECTA Antibody

[TECTA]

[Alpha-tectorin; tectorin alpha]

[alpha-tectorin; Alpha-tectorin; alpha-tectorin; tectorin alpha]

[TECTA]

[TECTA; TECTA; DFNA8; DFNA12; DFNB21]

Polyclonal

Rabbit IgG

Rabbit

Human, Mouse, Rat

2155

No cross reactivity with other proteins.

Immunogen affinity purified.

Lyophilized

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB), Immunohistochemistry (IHC) Paraffin

Western Blot: . Concentration: 0.1-0.5ug/ml. Tested Species: Hu, Ms, Rat. Immunohistochemistry(IHC) (Paraffin-embedded Section: . Concentration: 0.5-1ug/ml. Tested Species: Hu. Antigen Retrieval: By Heat. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Antibody can be supported by chemiluminescence kit MBS176460 in WB, supported by MBS176451 in IHC(P)

Western Blot (WB)

Immunohistochemistry (IHC)

Immunohistochemistry (IHC)

Immunohistochemistry (IHC)

TECTA was detected in paraffin-embedded sections of human testis tissues using rabbit anti- TECTA Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.

different from the related mouse sequence by three amino acids. Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2 mg Na 2 HPO 4 , 0.05 mg NaN 3
RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRK
YFK),
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Background: Alpha-tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.

1. "Entrez Gene: TECTA tectorin alpha". 2. Hughes DC, Legan PK, Steel KP, Richardson GP (Apr 1998). "Mapping of the alpha-tectorin gene (TECTA) to mouse chromosome 9 and human chromosome 11: a candidate for human autosomal dominant nonsyndromic deafness". Genomics. 48 (1): 46-51. 3. Verhoeven K, Van Laer L, Kirschhofer K, Legan PK, Hughes DC, Schatteman I, Verstreken M, Van Hauwe P, Coucke P, Chen A, Smith RJ, Somers T, Offeciers FE, Van de Heyning P, Richardson GP, Wachtler F, Kimberling WJ, Willems PJ, Govaerts PJ, Van Camp G (May 1998). "Mutations in the human alpha-tectorin gene cause autosomal dominant non-syndromic hearing impairment". Nat Genet. 19 (1): 60-2.

134268640

NP_005413.2

NM_005422.2

O75443

239,527 Da

Metabolism Of Proteins Pathway (1268677); Post-translational Modification: Synthesis Of GPI-anchored Proteins Pathway (1268710); Post-translational Protein Modification Pathway (1268701)

The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness. [provided by RefSeq, Jul 2008]

TECTA: One of the major non-collagenous components of the tectorial membrane. The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Defects in TECTA are the cause of deafness autosomal dominant type 12 (DFNA12); also known as DFNA8. DFNA12 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Defects in TECTA are the cause of deafness autosomal recessive type 21 (DFNB21). Protein type: Extracellular matrix; Membrane protein, GPI anchor. Chromosomal Location of Human Ortholog: 11q23.3. Disease: Deafness, Autosomal Dominant 12; Deafness, Autosomal Recessive 21

0.1 mg

315 USD