Anti-EPHX2 Antibody | MyBioSource MBS178659 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

Anti-EPHX2 Antibody

catalog :

MBS178659

quantity :

0.1 mg

price :

280 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

more info or order :

MyBioSource product webpage

image

image 1 :

Western blot analysis of EPHX2 expression in rat lung extract (lane 1), mouse lung extract (lane 2) and HEPG2 whole cell lysates (lane 3). EPHX2 at 62KD was detected using rabbit anti- EPHX2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

product information

catalog number :

MBS178659

products type :

Antibody

products full name :

Anti-EPHX2 Antibody

products short name :

[EPHX2]

products name syn :

[CEH; EPHX2; SEH; P34913; Bifunctional epoxide hydrolase 2; epoxide hydrolase 2]

other names :

[bifunctional epoxide hydrolase 2 isoform b; Bifunctional epoxide hydrolase 2; bifunctional epoxide hydrolase 2; epoxide hydrolase 2; Cytosolic epoxide hydrolase 2 (EC:3.3.2.10); CEHAlternative name(s):Epoxide hydratase; Soluble epoxide hydrolase; SEH]

products gene name :

[EPHX2]

other gene names :

[EPHX2; EPHX2; CEH; SEH; CEH; SEH]

clonality :

Polyclonal

isotype :

IgG

host :

Rabbit

reactivity :

Human, Mouse, Rat

sequence length :

502

specificity :

No cross reactivity with other proteins.

purity :

Immunogen affinity purified.

form :

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

storage stability :

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

tested application :

Western Blot (WB)

app notes :

Western Blot: 0.1-0.5ug/ml. Optimal dilutions shoudl be determined by end users.

image1 heading :

Western Blot (WB)

other info2 :

Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml. Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EPHX2 (505-543aa QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.

products description :

Rabbit IgG polyclonal antibody for Bifunctional epoxide hydrolase 2(EPHX2) detection. Background: Soluble epoxide hydrolase (sEH) is a bifunctional enzyme that in humans is encoded by the EPHX2 gene. It is mapped to 8p21.2-p21.1. This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.

products references :

1. "Entrez Gene: Epoxide hydrolase 2, cytoplasmic". 2. Morisseau C, Hammock BD (2013). "Impact of soluble epoxide hydrolase and epoxyeicosanoids on human health".Annu. Rev. Pharmacol. Toxicol. 53: 37-58. 3. Lee CR, North KE, Bray MS, Fornage M, Seubert JM, Newman JW, Hammock BD, Couper DJ, Heiss G, Zeldin DC (May 2006). "Genetic variation in soluble epoxide hydrolase (EPHX2) and risk of coronary heart disease: The Atherosclerosis Risk in Communities (ARIC) study". Hum. Mol. Genet.15 (10): 1640-9.

ncbi gi num :

374532800

ncbi acc num :

NP_001243411.1

ncbi gb acc num :

NM_001256482.1

uniprot acc num :

P34913

ncbi mol weight :

55,626 Da

ncbi pathways :

Arachidonate Epoxygenase / Epoxide Hydrolase Pathway (198838); Arachidonic Acid Metabolism Pathway (82991); Arachidonic Acid Metabolism Pathway (1270087); Arachidonic Acid Metabolism Pathway (366); Metabolic Pathways (132956); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001); Metapathway Biotransformation (198837); Peroxisome Pathway (131226); Peroxisome Pathway (131126)

ncbi summary :

This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]

uniprot summary :

EPHX2: Bifunctional enzyme. The C-terminal domain has epoxide hydrolase activity and acts on epoxides (alkene oxides, oxiranes) and arene oxides. Plays a role in xenobiotic metabolism by degrading potentially toxic epoxides. Also determines steady-state levels of physiological mediators. The N-terminal domain has lipid phosphatase activity, with the highest activity towards threo- 9,10-phosphonooxy-hydroxy-octadecanoic acid, followed by erythro- 9,10-phosphonooxy-hydroxy-octadecanoic acid, 12-phosphonooxy- octadec-9Z-enoic acid, 12-phosphonooxy-octadec-9E-enoic acid, and p-nitrophenyl phospate. Belongs to the AB hydrolase superfamily. Epoxide hydrolase family. Protein type: EC 3.1.3.76; EC 3.3.2.10; Hydrolase; Lipid Metabolism - arachidonic acid. Chromosomal Location of Human Ortholog: 8p21.2-p21.1. Cellular Component: cytoplasm; cytosol; peroxisome. Molecular Function: epoxide hydrolase activity; lipid phosphatase activity; magnesium ion binding; phosphoric monoester hydrolase activity; protein homodimerization activity; receptor binding; toxin binding. Biological Process: cholesterol homeostasis; dephosphorylation; epoxygenase P450 pathway; phospholipid dephosphorylation; stilbene catabolic process. Disease: Hypercholesterolemia, Familial

size1 :

0.1 mg

price1 :

280 USD

more info or order :

MyBioSource product webpage