Anti-IFNAR1 Antibody | MyBioSource MBS178600 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

Anti-IFNAR1 Antibody

catalog :

MBS178600

quantity :

0.1 mg

price :

280 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot

more info or order :

MyBioSource product webpage

image

image 1 :

Western blot analysis of IFNAR1 expression in HELA whole cell lysates (lane 1) and NIH3T3 whole cell lysates (lane 2). IFNAR1 at 64KD was detected using rabbit anti- IFNAR1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

product information

catalog number :

MBS178600

products type :

Antibody

products full name :

Anti-IFNAR1 Antibody

products short name :

[IFNAR1]

products name syn :

[AVP; CRF2-1; IFN alpha REC; IFN-R-1; IFNAR; Ifnar1; IFNBR; IFRC; P17181; Interferon alpha/beta receptor 1]

other names :

[interferon alpha/beta receptor 1; Interferon alpha/beta receptor 1; interferon alpha/beta receptor 1; interferon alpha and beta receptor subunit 1; Cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; CRF2-1; Type I interferon receptor 1]

products gene name :

[IFNAR1]

other gene names :

[IFNAR1; IFNAR1; AVP; IFRC; IFNAR; IFNBR; IFN-alpha-REC; IFNAR; IFN-R-1; IFN-alpha/beta receptor 1; CRF2-1]

clonality :

Polyclonal

isotype :

IgG

host :

Rabbit

reactivity :

Human, Mouse

sequence length :

557

purity :

Immunogen affinity purified.

form :

Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCI, 0.2 mg Na 2 HPO 4 , 0.05 mg,NaN 3

storage stability :

Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

tested application :

Western Blot (WB)

app notes :

Western Blot: . Concentration: 0.1-0.5ug/ml. Tested Species: Human, Mouse. Tested Species: In- house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

image1 heading :

Western Blot (WB)

other info2 :

HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKG
IYLLR).
Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml. Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa

products description :

Rabbit IgG polyclonal antibody for Interferon alpha/beta receptor 1(IFNAR1) detection. Background: Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.

products references :

1. "Entrez Gene: IFNAR1 interferon (alpha, beta and omega) receptor 1". 2. Abramovich C, Yakobson B, Chebath J, Revel M (Jan 1997). "A protein-arginine methyltransferase binds to the intracytoplasmic domain of the IFNAR1 chain in the type I interferon receptor". EMBO J. 16 (2): 260-6. 3. Yan H, Krishnan K, Greenlund AC, Gupta S, Lim JT, Schreiber RD, Schindler CW, Krolewski JJ (Mar 1996)."Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein". EMBO J. 15 (5): 1064-74.

ncbi gi num :

46488932

ncbi acc num :

NP_000620.2

ncbi gb acc num :

NM_000629.2

uniprot acc num :

P17181

ncbi pathways :

Cytokine Signaling In Immune System Pathway (1269310); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); Hepatitis B Pathway (694606); Hepatitis C Pathway (173973); Hepatitis C Pathway (173907); Herpes Simplex Infection Pathway (377873); Herpes Simplex Infection Pathway (377865); Immune System Pathway (1269170)

ncbi summary :

The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. [provided by RefSeq, Jul 2008]

uniprot summary :

IFNAR1: receptor for interferons alpha and beta. Belongs to the type II cytokine family of receptors. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves. Tyk2 tyrosine kinase is essential for stable cell surface expression of IFNAR1. Present in all tissues and even on the surface of most IFN-resistant cells. Protein type: Membrane protein, integral; Receptor, cytokine. Chromosomal Location of Human Ortholog: 21q22.11. Cellular Component: integral to plasma membrane; plasma membrane. Molecular Function: interferon-alpha/beta binding; interferon-alpha/beta receptor activity; protein binding. Biological Process: JAK-STAT cascade; response to lipopolysaccharide; response to virus

size1 :

0.1 mg

price1 :

280 USD

more info or order :

MyBioSource product webpage