Anti-ITGA2B Antibody | MyBioSource MBS178307 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

Anti-ITGA2B Antibody

catalog :

MBS178307

quantity :

0.1 mg

price :

315 USD

clonality :

polyclonal

host :

unidentified

conjugate :

nonconjugated

reactivity :

human, mouse, rat

more info or order :

MyBioSource product webpage

image

image 1 :

Western blot analysis of ITGA2B using anti- ITGA2B antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates,. Lane 2: mouse spleen tissue lysates,. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.

image 2 :

Anti- ITGA2B Picoband antibody, PB9647, IHC(P). IHC(P): Mouse Lung Tissue

image 3 :

Anti- ITGA2B Picoband antibody, PB9647, IHC(P). IHC(P): Rat Lung Tissue

product information

catalog number :

MBS178307

products type :

Antibody

products full name :

Anti-ITGA2B Antibody

products short name :

[ITGA2B]

products name syn :

[Integrin alpha-Iib; antigen CD41; BDPLT16; BDPLT2; CD41; CD41B; form 2; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; Integrin alpha 2b; Integrin alpha IIb; Integrin alpha-IIb light chain; Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITA2B_HUMAN; ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet specific antigen BAK; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)]

other names :

[integrin alpha-IIb preproprotein; Integrin alpha-IIb; integrin alpha-IIb; integrin subunit alpha 2b; GPalpha IIb; GPIIb]

products gene name :

[ITGA2B]

other gene names :

[ITGA2B; ITGA2B; GT; GTA; CD41; GP2B; HPA3; CD41B; GPIIb; BDPLT2; BDPLT16; PPP1R93; GP2B; ITGAB; GPIIb]

uniprot entry name :

ITA2B_HUMAN

clonality :

Polyclonal

host :

unknown

reactivity :

Human, Mouse, Rat

sequence length :

1039

specificity :

No cross reactivity with other proteins.

purity :

Immunogen Affinity Purified

form :

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

storage stability :

At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

app notes :

Western Blot . Concencentration 0.1-0.5 ug/mL. Tested Species: Mouse , Rat. Predicted Species: Human. Immunohistochemistry (Paraffin –embedded section) . Concentration: 0.5-1 ug/mL. Tested Species: Human, Mouse, Rat. Antigen Retrieval : By Heat. Tested Species: In house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0 for 20 mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

image1 heading :

Western Blot (WB)

image2 heading :

Testing Data

image3 heading :

Immunohistochemistry (IHC)

image4 heading :

Immunohistochemistry (IHC)

image4 description :

Anti- ITGA2B Picoband antibody, PB9647, IHC(P). IHC(P): Human Mammary Cancer Tissue

image5 heading :

Western Blot (WB)

image5 description :

Western blot analysis of ITGA2B using anti- ITGA2B antibody (PB9647). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HEK293 whole cell lysates,. Lane 2: human HepG2 whole cell lysates,. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- ITGA2B antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ITGA2B at approximately 125KD. The expected band size for ITGA2B is at 113KD.

other info1 :

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids. Ig Type: Rabbit IgG

other info2 :

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

products description :

Description: Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.

products references :

1. "Entrez Gene: ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)". 2. Naik UP, Parise LV (1997). "Structure and function of platelet alpha IIb beta 3.". Curr. Opin. Hematol. 4(5): 317-22. 3. Quinn MJ, Byzova TV, Qin J et al. (2004). "Integrin alphaIIbbeta3 and its antagonism.". Arterioscler. Thromb. Vasc. Biol. 23 (6): 945-52.

ncbi gi num :

88758615

ncbi acc num :

NP_000410.2

ncbi gb acc num :

NM_000419.4

uniprot acc num :

P08514

ncbi pathways :

ARMS-mediated Activation Pathway (1269471); Arf6 Signaling Events Pathway (138034); Arrhythmogenic Right Ventricular Cardiomyopathy Pathway (672454); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (117293); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (116129); Axon Guidance Pathway (1270303); Cytokine Signaling In Immune System Pathway (1269310); DAP12 Interactions Pathway (1269283); DAP12 Signaling Pathway (1269284); Developmental Biology Pathway (1270302)

ncbi summary :

This gene encodes a member of the integrin alpha chain family of proteins. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate through disulfide linkages to form a subunit of the alpha-IIb/beta-3 integrin cell adhesion receptor. This receptor plays a crucial role in the blood coagulation system, by mediating platelet aggregation. Mutations in this gene are associated with platelet-type bleeding disorders, which are characterized by a failure of platelet aggregation, including Glanzmann thrombasthenia. [provided by RefSeq, Jan 2016]

uniprot summary :

ITGA2B: Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha- IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface. Belongs to the integrin alpha chain family. Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-IIb associates with beta-3. Directly interacts with RNF181. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral. Chromosomal Location of Human Ortholog: 17q21.32. Cellular Component: cell surface; external side of plasma membrane; focal adhesion; integral to plasma membrane; integrin complex; plasma membrane; platelet alpha granule membrane. Molecular Function: extracellular matrix binding; identical protein binding; metal ion binding; protein binding. Biological Process: cell adhesion; cell-matrix adhesion; extracellular matrix organization and biogenesis; integrin-mediated signaling pathway; platelet degranulation; positive regulation of leukocyte migration. Disease: Bleeding Disorder, Platelet-type, 16; Glanzmann Thrombasthenia

size1 :

0.1 mg

price1 :

315 USD

more info or order :

MyBioSource product webpage