Anti-ERV31 Antibody | MyBioSource MBS178214 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

Anti-ERV31 Antibody

catalog :

MBS178214

quantity :

0.1 mg

price :

280 USD

clonality :

polyclonal

host :

unidentified

conjugate :

nonconjugated

reactivity :

human

application :

western blot, other

more info or order :

MyBioSource product webpage

image

image 1 :

Anti- ERV31 antibody, Western blotting

product information

catalog number :

MBS178214

products type :

Antibody

products full name :

Anti-ERV31 Antibody

products short name :

[ERV31]

products name syn :

[Endogenous retrovirus group 3 member 1 Env polyprotein; Endogenous retroviral sequence 3; Endogenous retrovirus group 3 member 1; ENR1_HUMAN; Envelope polyprotein; envR; ERV R; ERV-3 envelope protein; ERV-R envelope protein; ERV3 1 envelope protein; ERV3; ERV3 envelope protein; ERV3-1; ERVR; FLJ23884; HERV R; HERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; HERVR; SU; TM; Transmembrane protein; endogenous retrovirus group 3, member 1]

other names :

[endogenous retrovirus group 3 member 1 Env polyprotein; Endogenous retrovirus group 3 member 1 Env polyprotein; endogenous retrovirus group 3 member 1 Env polyprotein; endogenous retrovirus group 3 member 1; ERV-3 envelope protein; ERV3 envelope protein]

products gene name :

[ERV31]

other gene names :

[ERV3-1; ERV3-1; ERV3; ERVR; envR; ERV-R; HERVR; HERV-R; ERV3; ERV3 envelope protein; ERV-R envelope protein; SU; TM]

uniprot entry name :

ENR1_HUMAN

clonality :

Polyclonal

host :

unknown

reactivity :

Human

sequence length :

604

purity :

Immunogen Affinity Purified

form :

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

storage stability :

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

tested application :

Western Blot (WB). Other applications have not been tested.

app notes :

Western Blot: 0.1-0.5ug/ml / Tested Species: Hu (In-house tested species with positive results.). Optimal dilutions should be determined by end users.

image1 heading :

Western Blot (WB)

other info1 :

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG). Ig Type: Rabbit IgG

other info2 :

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

products description :

HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.

products references :

1. Kato, N., Shimotohno, K., Van Leeuwen, D., Cohen, M. Human proviral mRNAs down regulated in choriocarcinoma encode a zinc finger protein related to Kruppel. Molec. Cell. Biol. 10: 4401-4405, 1990. 2. Kim, H.-S., Crow, T. J., Hyun, B.-H. Assignment of the endogenous retrovirus HERV-R (ERV3) to human chromosome 7q11.2 by radiation hybrid mapping. Cytogenet. Cell Genet. 89: 10 only, 2000. 3. O'Connell C, O'Brien S, Nash WG, Cohen M (Dec 1984). "ERV3, a full-length human endogenous provirus: chromosomal localization and evolutionary relationships". Virology 138 (2): 225-35.

ncbi gi num :

145651814

ncbi acc num :

NP_001007254.2

ncbi gb acc num :

NM_001007253.3

uniprot acc num :

Q14264

ncbi summary :

The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma. [provided by RefSeq, Jul 2008]

uniprot summary :

ERV3: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro. Belongs to the gamma type-C retroviral envelope protein family. HERV class-I R env subfamily. Chromosomal Location of Human Ortholog: 7q11.2. Cellular Component: viral envelope

size1 :

0.1 mg

price1 :

280 USD

more info or order :

MyBioSource product webpage