antibody

Anti-CD26 Antibody

MBS177941

0.1 mg

280 USD

polyclonal

unidentified

nonconjugated

human, rat

Antibody

Anti-CD26 Antibody

[CD26]

[Dipeptidyl peptidase 4; CD26 antigen; ADA-binding protein; ADABP; ADCP 2; ADCP-2; ADCP2; Adenosine deaminase complexing protein 2; CD 26; CD26; CD26 antigen 3; Dipeptidyl peptidase 4; Dipeptidyl peptidase 4 soluble form; Dipeptidyl peptidase IV; Dipeptidyl peptidase IV membrane form; Dipeptidyl peptidase IV soluble form; Dipeptidyl peptidase, intestinal; Dipeptidylpeptidase 4; Dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); Dipeptidylpeptidase IV; DPP 4; DPP IV; DPP IV estoenzyme; DPP4; DPP4_HUMAN; DPPIV; Intestinal dipeptidyl peptidase; T cell activation antigen CD26; T-cell activation antigen CD26; TP 103; TP103; dipeptidyl-peptidase 4]

[dipeptidyl peptidase 4; Dipeptidyl peptidase 4; dipeptidyl peptidase 4; dipeptidyl peptidase 4; ADABP; Adenosine deaminase complexing protein 2; ADCP-2]

[CD26]

[DPP4; DPP4; CD26; ADABP; ADCP2; DPPIV; TP103; ADCP2; CD26; ADCP-2; DPP IV]

DPP4_HUMAN

Polyclonal

unknown

Human, Rat

766

No cross reactivity with other proteins.

Immunogen Affinity Purified

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

Western Blot. Concentration: 0.1-0.5ug/ml. Tested Species: Human, Rat . Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Western Blot (WB)

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ), different from the related mouse and rat sequences by three amino acids. Ig Type: Rabbit IgG

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Description: Rabbit IgG polyclonal antibody for Dipeptidyl peptidase 4(DPP4) detection. Tested with WB in Human;Rat. Background: Dipeptidyl peptidase-4 (DPP4), also known as CD26 (cluster of differentiation 26) is a protein that, in humans, is encoded by the DPP4 gene. The protein encoded by the DPP4 gene is an antigenic enzyme expressed on the surface of most cell types and is associated with immune regulation, signal transduction and apoptosis. Also, it is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. DPP4 plays a major role in glucose metabolism. It is responsible for the degradation ofincretins such as GLP-1. Furthermore, it appears to work as a suppressor in the development of cancer andtumours.

1. Barnett A (Nov 2006). "DPP-4 inhibitors and their potential role in the management of type 2 diabetes".International Journal of Clinical Practice60 (11): 1454-70. 2. Kameoka J, Tanaka T, Nojima Y, Schlossman SF, Morimoto C (Jul 1993). "Direct association of adenosine deaminase with a T cell activation antigen, CD26".Science 261 (5120): 466-9. 3. Pro B, Dang NH (Oct 2004). "CD26/dipeptidyl peptidase IV and its role in cancer". Histology and Histopathology 19 (4): 1345-51.

18765694

NP_001926.2

NM_001935.3

P27487

88,279 Da

Incretin Synthesis, Secretion, And Inactivation Pathway (1268750); Metabolism Of Proteins Pathway (1268677); Peptide Hormone Metabolism Pathway (1268746); Protein Digestion And Absorption Pathway (172847); Protein Digestion And Absorption Pathway (171868); Synthesis, Secretion, And Inactivation Of Glucagon-like Peptide-1 (GLP-1) Pathway (1268751); Synthesis, Secretion, And Inactivation Of Glucose-dependent Insulinotropic Polypeptide (GIP) Pathway (1268752)

The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. [provided by RefSeq, Jul 2008]

DPP4: Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF- kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. Belongs to the peptidase S9B family. DPPIV subfamily. Protein type: Protease; Cell surface; Cell adhesion; EC 3.4.14.5; Membrane protein, integral. Chromosomal Location of Human Ortholog: 2q24.3. Cellular Component: apical plasma membrane; cell surface; endocytic vesicle; focal adhesion; integral to membrane; intercellular canaliculus; lamellipodium; lipid raft; lysosomal membrane; membrane; plasma membrane. Molecular Function: dipeptidyl-peptidase activity; identical protein binding; protease binding; protein binding; protein homodimerization activity; receptor binding; serine-type endopeptidase activity; serine-type peptidase activity; viral receptor activity. Biological Process: behavioral fear response; endothelial cell migration; entry of virus into host cell; positive regulation of cell proliferation; proteolysis; regulation of cell-cell adhesion mediated by integrin; response to hypoxia; T cell activation; T cell costimulation

0.1 mg

280 USD