Anti-SLC10A1 Antibody | MyBioSource MBS177905 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

Anti-SLC10A1 Antibody

catalog :

MBS177905

quantity :

0.1 mg

price :

315 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry, FACS, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

MyBioSource product webpage

image

image 1 :

Western blot analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysates,. Lane 2: mouse liver tissue lysates,. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- SLC10A1 antigen affinity purified polyclonal antibody (MBS177905) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (MBS176460) with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50KD. The expected band size for SLC10A1 is at 38KD.

image 2 :

IF analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905). SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/mL rabbit anti- SLC10A1 Antibody (MBS177905) overnight at 4°C. DyLight 550 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

image 3 :

IF analysis of SLC10A1 using anti- SLC10A1 antibody (MBS177905). SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/mL rabbit anti- SLC10A1 Antibody (MBS177905) overnight at 4°C. DyLight 488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

product information

catalog number :

MBS177905

products type :

Antibody

products full name :

Anti-SLC10A1 Antibody

products short name :

[SLC10A1]

products name syn :

[Sodium/bile acid cotransporter; Cell growth-inhibiting gene 29 protein; Growth inhibiting protein 29; Na / bile acid cotransporter; Na / taurocholate transport protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NTCP; NTCP_HUMAN; NTCP1; SLC10A1; Sodium/bile acid cotransporter; Sodium/taurocholate cotransporter; Sodium/taurocholate cotransporting polypeptide; Solute carrier family 10 (sodium/bile acid cotransporter family) member 1; Solute carrier family 10 member 1 antibody; solute carrier family 10 (sodium/bile acid cotransporter family), member 1]

other names :

[sodium/bile acid cotransporter isoform 1; Sodium/bile acid cotransporter; sodium/bile acid cotransporter; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Sodium/taurocholate cotransporting polypeptide; Solute carrier family 10 member 1]

products gene name :

[SLC10A1]

other gene names :

[Slc10a1; Slc10a1; Ntcp; Ntcp]

uniprot entry name :

NTCP_MOUSE

clonality :

Polyclonal

isotype :

IgG

host :

Rabbit

reactivity :

Human, Mouse, Rat

specificity :

No cross reactivity with other proteins.

purity :

Immunogen affinity purified.

form :

Lyophilized; Contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

concentration :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

storage stability :

At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

tested application :

Flow Cytometry (FC/FACS), Immunofluorescence (IF), Immunohistochemistry-Paraffin (IHC-P), Immunohistochemistry-Frozen (IHC-F), Immunocytochemistry (ICC), Western Blot (WB)

app notes :

Suggested Dilutions:. IHC-P: 0.5-1ug/ml, By Heat. IHC-F: 0.5-1ug/ml. WB: 0.1-0.5ug/ml. ICC: 0.5-1ug/ml. FC/FACS: 1-3ug/1x10 6 cells. IF: 2ug/ml. Recommended Detection Systems: . - Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for WB . - HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (please inquire) for IHC-P, IHC-F and ICC. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.

image1 heading :

Western Blot (WB)

image2 heading :

Immunofluorescence (IF)

image3 heading :

Immunofluorescence (IF)

image4 heading :

Flow Cytometry (FC/FACS)

image4 description :

Flow Cytometry analysis of BRL cells using anti-SLC10A1 antibody (MBS177905). Overlay histogram showing BRL cells stained with MBS177905 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SLC10A1 Antibody (MBS177905,1ug/1x10 6 cells) for 30 min at 20°C. DyLight 488 conjugated goat anti-rabbit IgG (5-10ug/1x10 6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x10 6 ) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

image5 heading :

Immunohistochemistry (IHC)

image5 description :

IHC analysis of SLC10A1 using anti-SLC10A1 antibody (MBS177905). SLC10A1 was detected in frozen section of mouse liver tissue. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-SLC10A1 Antibody (MBS177905) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(MBS176451) with DAB as the chromogen.

other info1 :

different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids.
EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAAL
EK),
Conjugate: No. Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa

other info2 :

Reconstitution: 0.2mL of distilled water will yeild a concentration of 500ug/ml.

products description :

Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity. Rabbit IgG polyclonal antibody for Sodium/bile acid cotransporter (SLC10A1) detection. Tested with WB, IHC-P, IHC-F, ICC, FC/FACS, IF in Human; Mouse; Rat.

products references :

1. Eloranta JJ, Jung D, Kullak-Ublick GA (2006). "The human Na+-taurocholate cotransporting polypeptide gene is activated by glucocorticoid receptor and peroxisome proliferator-activated receptor-gamma coactivator-1alpha, and suppressed by bile acids via a small heterodimer partner-dependent mechanism.". Mol. Endocrinol. 20 (1): 65-79. 2. Ho RH, Leake BF, Roberts RL, et al. (2004). "Ethnicity-dependent polymorphism in Na+-taurocholate cotransporting polypeptide (SLC10A1) reveals a domain critical for bile acid substrate recognition.". J. Biol. Chem. 279 (8): 7213-22.

ncbi gi num :

294774569

ncbi acc num :

NP_001171032.1

ncbi gb acc num :

NM_001177561.1

uniprot acc num :

O08705

ncbi pathways :

Bile Acid And Bile Salt Metabolism Pathway (1367698); Bile Secretion Pathway (193148); Bile Secretion Pathway (193095); Metabolism Pathway (1367614); Metabolism Of Lipids And Lipoproteins Pathway (1367657); Recycling Of Bile Acids And Salts Pathway (1367703)

uniprot summary :

NTCP: The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium. Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter. Cellular Component: basolateral plasma membrane; integral to membrane; integral to plasma membrane; membrane. Molecular Function: bile acid transmembrane transporter activity; bile acid:sodium symporter activity; symporter activity. Biological Process: bile acid and bile salt transport; ion transport; sodium ion transport; transport

size1 :

0.1 mg

price1 :

315 USD

more info or order :

MyBioSource product webpage