product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
Anti-SECTM1 Antibody
catalog :
MBS177755
quantity :
0.1 mg
price :
280 USD
clonality :
polyclonal
host :
unidentified
conjugate :
nonconjugated
reactivity :
mouse
application :
western blot
more info or order :
image
image 1 :
Anti- SECTM1 Picoband antibody, MBS177755, Western blotting. All lanes: Anti SECTM1 (MBS177755) at 0.5ug/ml. WB : HEPA Whole Cell Lysate at 40ug. Predicted bind size: 23KD. Observed bind size: 23KD
product information
catalog number :
MBS177755
products type :
Antibody
products full name :
Anti-SECTM1 Antibody
products short name :
[SECTM1]
products name syn :
[Secreted and transmembrane protein 1b; K12; K12 protein; Protein K-12; Protein K12; SCTM1_HUMAN; Secreted and transmembrane 1; Secreted and transmembrane protein 1; SECTM 1; SECTM1; Type 1a transmembrane protein; secreted and transmembrane 1]
other names :
[Secreted and transmembrane protein 1b; Secreted and transmembrane protein 1b; secreted and transmembrane protein 1b; secreted and transmembrane 1B; Protein K-12]
products gene name :
[SECTM1]
other gene names :
[Sectm1b; Sectm1b; K12; Sectm1; 1810003C24Rik; K12; Sectm1]
uniprot entry name :
SCT1B_MOUSE
clonality :
Polyclonal
isotype :
IgG
host :
unknown
reactivity :
Mouse
sequence length :
212
specificity :
No cross reactivity with other proteins.
purity :
Immunogen Affinity Purified
form :
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
storage stability :
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
tested application :
Western Blot (WB)
app notes :
Western Blot. Concentration: 0.1-0.5ug/ml. Tested Species: Ms. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK).
other info2 :
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
products description :
Description: Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(SECTM1) detection. Tested with WB in Mouse. Background: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
products references :
1. "Entrez Gene: SECTM1 secreted and transmembrane 1". 2. Lyman SD, Escobar S, Rousseau AM et al. (2000). "Identification of CD7 as a cognate of the human K12 (SECTM1) protein". J. Biol. Chem. 275 (5): 3431-7. 3. Slentz-Kesler KA, Hale LP, Kaufman RE (Apr 1998). "Identification and characterization of K12 (SECTM1), a novel human gene that encodes a Golgi-associated protein with transmembrane and secreted isoforms". Genomics47 (3): 327-40.
ncbi gi num :
25009252
ncbi acc num :
Q9JL59.1
uniprot acc num :
Q9JL59
uniprot summary :
Sectm1b: May be involved in thymocyte signaling. Belongs to the SECTM family. Cellular Component: extracellular region; integral to membrane; integral to plasma membrane; membrane; plasma membrane. Molecular Function: signal transducer activity. Biological Process: immune response
size1 :
0.1 mg
price1 :
280 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
browse more products
questions and comments