Polyclonal Anti-NR3C2 Picoband TM Antibody | MyBioSource MBS177661 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

Polyclonal Anti-NR3C2 Picoband TM Antibody

catalog :

MBS177661

quantity :

0.1 mg

price :

280 USD

clonality :

polyclonal

host :

unidentified

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

more info or order :

MyBioSource product webpage

image

image 1 :

Figure 1. Western blot analysis of NR3C2 using anti-NR3C2 antibody (MBS177661). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: Rat Kidney Tissue Lysate,. Lane 2: Mouse Kidney Tissue Lysate,. Lane 3: HELA Whole Cell Lysate,. Lane 4: A431 Whole Cell Lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-NR3C2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NR3C2 at approximately 110KD. The expected band size for NR3C2 is at 110KD.

image 2 :

Figure 2. Western blot analysis of NR3C2 using anti- NR3C2 antibody (MBS177661). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: mouse brain tissue lysates,. Lane 2: rat brain tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- NR3C2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NR3C2 at approximately 110KD. The expected band size for NR3C2 is at 110KD.

product information

catalog number :

MBS177661

products type :

Antibody

products full name :

Polyclonal Anti-NR3C2 Picoband TM Antibody

products short name :

[NR3C2]

products name syn :

[Mineralocorticoid receptor; Aldosterone receptor; MCR; MCR_HUMAN; MGC133092; Mineralocorticoid receptor; MLR; MR; NR3 C2; NR3C2; NR3C2 protein; Nuclear receptor subfamily 3 group C member 2 antibody; nuclear receptor subfamily 3, group C, member 2]

other names :

[mineralocorticoid receptor isoform 1; Mineralocorticoid receptor; mineralocorticoid receptor; nuclear receptor subfamily 3 group C member 2; Nuclear receptor subfamily 3 group C member 2]

products gene name :

[NR3C2]

other gene names :

[NR3C2; NR3C2; MR; MCR; MLR; NR3C2VIT; MCR; MLR; MR]

uniprot entry name :

MCR_HUMAN

clonality :

polyclonal

host :

unknown

reactivity :

Human, Mouse, Rat

sequence length :

984

specificity :

No Cross reactivity with other proteins.

purity :

Immunogen Affinity Purified

form :

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

storage stability :

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

tested application :

Western Blot (WB)

app notes :

Western Blot. Concentration: 0.1-0.5ug/ml. Tested Species: Hu,Ms,Rat; In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

image1 heading :

Western Blot (WB)

image2 heading :

Western Blot (WB)

other info1 :

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. Ig Type: Rabbit IgG

other info2 :

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml. Relevant Detection Systems: MBS provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit MBS176460 in WB.

products description :

Description: Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human;Mouse;Rat. Background: NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

products references :

1. Fan YS, Eddy RL, Byers MG, Haley LL, Henry WM, Nowak NJ, Shows TB (1989). "The human mineralocorticoid receptor gene (MLR) is located on chromosome 4 at q31.2". Cytogenet. Cell Genet.52 (1-2): 83-4. 2. Zennaro MC, Souque A, Viengchareun S, Poisson E, Lombès M (September 2001). "A new human MR splice variant is a ligand-independent transactivator modulating corticosteroid action". Mol. Endocrinol. 15 (9): 1586-98.

ncbi gi num :

158508572

ncbi acc num :

NP_000892.2

ncbi gb acc num :

NM_000901.4

uniprot acc num :

P08235

ncbi mol weight :

94,359 Da

ncbi pathways :

ACE Inhibitor Pathway (198763); Aldosterone-regulated Sodium Reabsorption Pathway (130626); Aldosterone-regulated Sodium Reabsorption Pathway (130590); Gene Expression Pathway (1269649); Generic Transcription Pathway (1269650); Nuclear Receptor Transcription Pathway (1269652)

ncbi summary :

This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

uniprot summary :

MCR: Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels. Defects in NR3C2 are a cause of autosomal dominant pseudohypoaldosteronism type I (AD-PHA1). PHA1 is characterized by urinary salt wasting, resulting from target organ unresponsiveness to mineralocorticoids. There are 2 forms of PHA1: the autosomal dominant form that is mild, and the recessive form which is more severe and due to defects in any of the epithelial sodium channel subunits. In AD-PHA1 the target organ defect is confined to kidney. Clinical expression can vary from asymptomatic to moderate. It may be severe at birth, but symptoms remit with age. Familial and sporadic cases have been reported. Defects in NR3C2 are a cause of early-onset hypertension with severe exacerbation in pregnancy (EOHSEP). Inheritance is autosomal dominant. The disease is characterized by the onset of severe hypertension before the age of 20, and by suppression of aldosterone secretion. Belongs to the nuclear hormone receptor family. NR3 subfamily. 4 isoforms of the human protein are produced by alternative splicing. Protein type: DNA-binding; Nuclear receptor. Chromosomal Location of Human Ortholog: 4q31.1. Cellular Component: endoplasmic reticulum membrane; nucleoplasm; receptor complex. Molecular Function: protein binding; sequence-specific DNA binding; steroid binding; steroid hormone receptor activity; transcription factor activity; zinc ion binding. Biological Process: regulation of transcription, DNA-dependent; signal transduction; steroid hormone mediated signaling; transcription initiation from RNA polymerase II promoter. Disease: Hypertension, Early-onset, Autosomal Dominant, With Severe Exacerbation In Pregnancy; Pseudohypoaldosteronism, Type I, Autosomal Dominant

size1 :

0.1 mg

price1 :

280 USD

more info or order :

MyBioSource product webpage