Recombinant Human Receptor-type tyrosine-protein phosphatase N2 | MyBioSource MBS1485236 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Receptor-type tyrosine-protein phosphatase N2

catalog :

MBS1485236

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1485236

products type :

Recombinant Protein

products full name :

Recombinant Human Receptor-type tyrosine-protein phosphatase N2

products short name :

Receptor-type tyrosine-protein phosphatase N2

products name syn :

Islet cell autoantigen-related protein; IAR; ICAAR; Phogrin

other names :

Receptor-type tyrosine-protein phosphatase N2; receptor-type tyrosine-protein phosphatase N2; protein tyrosine phosphatase, receptor type N2; Islet cell autoantigen-related protein

products gene name :

PTPRN2

other gene names :

PTPRN2; PTPRN2; IAR; ICAAR; PTPRP; IA-2beta; R-PTP-N2; KIAA0387; ICAAR

uniprot entry name :

PTPR2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

22-615

sequence length :

998

sequence :

AAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGR
CQKVPAMDFYRYEVSPVALQRLRVALQKLSGTGFTWQDD
YTQYVMDQELADLPKTYLRRPEASSPARPSKHSVGSERR
YSREGGAALANALRRHLPFLEALSQAPASDVLARTHTAQ
DRPPAEGDDRFSESILTYVAHTSALTYPPGSRTQLREDL
LPRTLGQLQPDELSPKVDSGVDRHHLMAALSAYAAQRPP
APPGEGSLEPQYLLRAPSRMP

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Implicated in development of nervous system and pancreatic endocrine cells.

products references :

Molecular cloning and characterization of the human transmembrane protein tyrosine phosphatase homologue, phogrin, an autoantigen of type 1 diabetes.Kawasaki E., Hutton J.C., Eisenbarth G.S.Biochem. Biophys. Res. Commun. 227:440-447(1996) ICAAR, a novel member of a new family of transmembrane, tyrosine phosphatase-like proteins.Smith P.D., Barker K.T., Wang J., Lu Y.-J., Shipley J., Crompton M.R.Biochem. Biophys. Res. Commun. 229:402-411(1996) Cloning and characterization of islet cell antigen-related protein-tyrosine phosphatase (PTP) , a novel receptor-like PTP and autoantigen in insulin-dependent diabetes.Cui L., Yu W.-P., de Aizpurua H.J., Schmidli R.S., Pallen C.J.J. Biol. Chem. 271:24817-24823(1996) Characterization and chromosomal localization of PTPRP, a receptor protein tyrosine phosphatase predominantly expressed in brain and pancreas.Jiang S., Tulloch G., Fu Y., London R., Hummel G.S., White R.A., Avraham H., Avraham S. Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 4:141-150(1997) Construction of expression-ready cDNA clones for KIAA genes manual curation of 330 KIAA cDNA clones.Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.DNA Res. 9:99-106(2002) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Large-scale structural analysis of the classical human protein tyrosine phosphatome.Barr A.J., Ugochukwu E., Lee W.H., King O.N.F., Filippakopoulos P., Alfano I., Savitsky P., Burgess-Brown N.A., Mueller S., Knapp S.Cell 136:352-363(2009) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006)

ncbi acc num :

NP_001295196.1

uniprot acc num :

Q92932

ncbi mol weight :

66.15kD

ncbi pathways :

Type I Diabetes Mellitus Pathway (83095); Type I Diabetes Mellitus Pathway (507)

ncbi summary :

This gene encodes a protein with sequence similarity to receptor-like protein tyrosine phosphatases. However, tyrosine phosphatase activity has not been experimentally validated for this protein. Studies of the rat ortholog suggest that the encoded protein may instead function as a phosphatidylinositol phosphatase with the ability to dephosphorylate phosphatidylinositol 3-phosphate and phosphatidylinositol 4,5-diphosphate, and this function may be involved in the regulation of insulin secretion. This protein has been identified as an autoantigen in insulin-dependent diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

uniprot summary :

PTPRN2: Implicated in development of nervous system and pancreatic endocrine cells. Belongs to the protein-tyrosine phosphatase family. Receptor class 8 subfamily. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Receptor protein phosphatase, tyrosine; EC 3.1.3.48. Chromosomal Location of Human Ortholog: 7q36. Cellular Component: cell junction; endoplasmic reticulum lumen; integral to plasma membrane; receptor complex; secretory granule membrane; synaptic vesicle membrane; terminal button. Molecular Function: transmembrane receptor protein tyrosine phosphatase activity. Biological Process: protein amino acid dephosphorylation

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1395

more info or order :

MyBioSource product webpage