catalog number :
MBS1471528
products type :
Recombinant Protein
products full name :
Recombinant Pseudomonas aeruginosa Lysyl endopeptidase
products short name :
[Lysyl endopeptidase]
products name syn :
[Protease IV; pvdS-regulated endoprotease]
other names :
[endopeptidase IV; Lysyl endopeptidase; endopeptidase IV; Protease IV; PvdS-regulated endoprotease]
products gene name :
[prpL]
other gene names :
[piv; prpL]
uniprot entry name :
LYSC_PSEAE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[212-462. Full Length of Mature Protein]
sequence :
AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMV
FTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQA
TAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHR
DAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIH
HPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEG
GSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDY
FSDFSGVYSQISRYFAP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Lysine-specific endoprotease. Involved in corneal virulence.
products references :
Identification of the active site residues of Pseudomonas aeruginosa protease IV. Importance of enzyme activity in autoprocessing and activation.Traidej M., Marquart M.E., Caballero A.R., Thibodeaux B.A., O'Callaghan R.J.J. Biol. Chem. 278:2549-2553(2003)
PrpL protease of Pseudomonas aeruginosa
an important virulence determinant in corneal infections.Parveen N., Parker D.S., Fan L., Leong J.M., Goguen J.D. Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen.Stover C.K., Pham X.-Q.T., Erwin A.L., Mizoguchi S.D., Warrener P., Hickey M.J., Brinkman F.S.L., Hufnagle W.O., Kowalik D.J., Lagrou M., Garber R.L., Goltry L., Tolentino E., Westbrock-Wadman S., Yuan Y., Brody L.L., Coulter S.N., Folger K.R., Kas A., Larbig K., Lim R.M., Smith K.A., Spencer D.H., Wong G.K.-S., Wu Z., Paulsen I.T., Reizer J., Saier M.H. Jr., Hancock R.E.W., Lory S., Olson M.V.Nature 406:959-964(2000)
Lahnstein J.Submitted (APR-2000)
to UniProtKB
ncbi acc num :
NP_252864.1
ncbi gb acc num :
NC_002516.2
uniprot summary :
Lysine-specific endoprotease (PubMed:12419815). Involved in corneal virulence.
size6 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)