product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Deoxyribonuclease gamma (DNASE1L3)
catalog :
MBS1467924
quantity :
0.01 mg (E-Coli)
price :
200 USD
more info or order :
image
image 1 :
MyBioSource MBS1467924 image 1
product information
catalog number :
MBS1467924
products type :
Recombinant Protein
products full name :
Recombinant Human Deoxyribonuclease gamma (DNASE1L3)
products short name :
[Deoxyribonuclease gamma (DNASE1L3)]
products name syn :
[DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen Dnase; LS-Dnase; LSD]
other names :
[deoxyribonuclease gamma isoform 2; Deoxyribonuclease gamma; deoxyribonuclease gamma; deoxyribonuclease I-like 3; DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen DNase; LS-DNase; LSD]
products gene name :
[DNASE1L3]
other gene names :
[DNASE1L3; DNASE1L3; LSD; DHP2; SLEB16; DNAS1L3; DHP2; DNAS1L3; DNase gamma; DNase I-like 3; LS-DNase; LSD]
uniprot entry name :
DNSL3_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[21-305. Full Length of Mature Protein]
sequence :
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVME
IKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTY
KEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVV
WFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVK
HRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVW
LIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSV
FDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKS
VTLRKKTKSKRS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Species: Homo sapiens (Human). Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Cell Biology
products description :
Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units.
products references :
Identification, localization, and expression of two novel human genes similar to deoxyribonuclease I." Rodriguez A.M., Rodin D., Nomura H., Morton C.C., Weremowicz S., Schneider M.C. Genomics 42:507-513(1997)
ncbi gi num :
375151549
ncbi acc num :
NP_001243489.1
ncbi gb acc num :
NM_001256560.1
uniprot acc num :
Q13609
ncbi mol weight :
60.04kD
ncbi summary :
This gene encodes a member of the deoxyribonuclease I family. The encoded protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Mutations in this gene are a cause of systemic lupus erythematosus-16. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]
uniprot summary :
DNASE1L3: Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units. Defects in DNASE1L3 are the cause of systemic lupus erythematosus type 16 (SLEB16). A rare autosomal recessive form of systemic lupus erythematosus with childhood onset, characterized by high frequency of anti-neutrophil cytoplasmic antibodies and lupus nephritis. Systemic lupus erythematosus is a chronic, relapsing, inflammatory, and often febrile multisystemic disorder of connective tissue, characterized principally by involvement of the skin, joints, kidneys and serosal membranes. It is of unknown etiology, but is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The disease is marked by a wide range of system dysfunctions, an elevated erythrocyte sedimentation rate, and the formation of LE cells in the blood or bone marrow. Belongs to the DNase I family. Protein type: EC 3.1.21.-; Secreted, signal peptide; Calcium-binding; Deoxyribonuclease; Apoptosis; Secreted. Chromosomal Location of Human Ortholog: 3p14.3. Cellular Component: nucleus. Molecular Function: calcium ion binding; deoxyribonuclease activity; DNA binding; endodeoxyribonuclease activity, producing 5'-phosphomonoesters. Biological Process: DNA fragmentation during apoptosis; DNA metabolic process. Disease: Systemic Lupus Erythematosus 16
size1 :
0.01 mg (E-Coli)
price1 :
200 USD
size2 :
0.01 mg (Baculovirus)
price2 :
255
size3 :
0.05 mg (E-Coli)
price3 :
260
size4 :
0.02 mg (Baculovirus)
price4 :
395
size5 :
0.1 mg (E-Coli)
price5 :
430
size6 :
0.2 mg (E-Coli)
price6 :
685
size7 :
0.05 mg (Baculovirus)
price7 :
755
size8 :
0.05 mg (Yeast)
price8 :
820
size9 :
0.1 mg (Baculovirus)
price9 :
1040
size10 :
0.2 mg (Yeast)
price10 :
1105
size11 :
0.5 mg (E-Coli)
price11 :
1125
size12 :
0.5 mg (Yeast)
price12 :
1250
size13 :
0.05 mg (Mammalian-Cell)
price13 :
1275
size14 :
0.5 mg (Baculovirus)
price14 :
1480
size15 :
1 mg (E-Coli)
price15 :
1725
size16 :
1 mg (Yeast)
price16 :
1970
size17 :
1 mg (Baculovirus)
price17 :
2060
size18 :
0.1 mg (Mammalian-Cell)
price18 :
2070
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!