catalog number :
MBS1467924
products type :
Recombinant Protein
products full name :
Recombinant Human Deoxyribonuclease gamma (DNASE1L3)
products short name :
[Deoxyribonuclease gamma (DNASE1L3)]
products name syn :
[DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen Dnase; LS-Dnase; LSD]
other names :
[deoxyribonuclease gamma isoform 2; Deoxyribonuclease gamma; deoxyribonuclease gamma; deoxyribonuclease I-like 3; DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen DNase; LS-DNase; LSD]
products gene name :
[DNASE1L3]
other gene names :
[DNASE1L3; DNASE1L3; LSD; DHP2; SLEB16; DNAS1L3; DHP2; DNAS1L3; DNase gamma; DNase I-like 3; LS-DNase; LSD]
uniprot entry name :
DNSL3_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[21-305. Full Length of Mature Protein]
sequence :
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVME
IKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTY
KEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVV
WFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVK
HRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVW
LIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSV
FDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKS
VTLRKKTKSKRS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info2 :
Species: Homo sapiens (Human). Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Cell Biology
products description :
Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units.
products references :
Identification, localization, and expression of two novel human genes similar to deoxyribonuclease I."
Rodriguez A.M., Rodin D., Nomura H., Morton C.C., Weremowicz S., Schneider M.C.
Genomics 42:507-513(1997)
ncbi acc num :
NP_001243489.1
ncbi gb acc num :
NM_001256560.1
ncbi mol weight :
60.04kD
ncbi summary :
This gene encodes a member of the deoxyribonuclease I family. The encoded protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Mutations in this gene are a cause of systemic lupus erythematosus-16. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]
uniprot summary :
DNASE1L3: Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units. Defects in DNASE1L3 are the cause of systemic lupus erythematosus type 16 (SLEB16). A rare autosomal recessive form of systemic lupus erythematosus with childhood onset, characterized by high frequency of anti-neutrophil cytoplasmic antibodies and lupus nephritis. Systemic lupus erythematosus is a chronic, relapsing, inflammatory, and often febrile multisystemic disorder of connective tissue, characterized principally by involvement of the skin, joints, kidneys and serosal membranes. It is of unknown etiology, but is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The disease is marked by a wide range of system dysfunctions, an elevated erythrocyte sedimentation rate, and the formation of LE cells in the blood or bone marrow. Belongs to the DNase I family. Protein type: EC 3.1.21.-; Secreted, signal peptide; Calcium-binding; Deoxyribonuclease; Apoptosis; Secreted. Chromosomal Location of Human Ortholog: 3p14.3. Cellular Component: nucleus. Molecular Function: calcium ion binding; deoxyribonuclease activity; DNA binding; endodeoxyribonuclease activity, producing 5'-phosphomonoesters. Biological Process: DNA fragmentation during apoptosis; DNA metabolic process. Disease: Systemic Lupus Erythematosus 16
size2 :
0.01 mg (Baculovirus)
size4 :
0.02 mg (Baculovirus)
size7 :
0.05 mg (Baculovirus)
size9 :
0.1 mg (Baculovirus)
size13 :
0.05 mg (Mammalian-Cell)
size14 :
0.5 mg (Baculovirus)
size17 :
1 mg (Baculovirus)
size18 :
0.1 mg (Mammalian-Cell)