catalog number :
MBS1452870
products type :
Recombinant Protein
products full name :
Recombinant Human metapneumovirus Matrix protein (M)
products short name :
[Matrix protein (M)]
other names :
[matrix protein; Matrix protein; M]
products gene name syn :
[M]
other gene names :
[M; M]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-254. Full Length]
sequence :
MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLF
QANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQG
AAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYL
TTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNT
PVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIA
PYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAES
ISKICKTWSHQGTRYVLKSR
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Human metapneumovirus (strain CAN97-83) (HMPV)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi acc num :
YP_012607.1
ncbi gb acc num :
NC_004148.2
ncbi mol weight :
27,612 Da
uniprot summary :
Has a crucial role in virus assembly and budding. The matrix interacts with the RNP complex and this association serves two functions: facilitate virion assembly and inhibit the viral transcriptase activity. Early in infection, M is localized to the nucleus and may inhibit host cell transcription. Later on, M can associate with lipid rafts supposely by interacting with the cytoskeleton and with the cytoplasmic tail of glycoprotein G. The binding of M to host membrane is stabilized by the surface expression of the viral glycoproteins. These interactions may allow virus formation by mediating association of the nucleocapsid with the nascent envelope ().
size6 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)