catalog number :
MBS1451771
products type :
Recombinant Protein
products full name :
Recombinant Mouse Cytoskeleton-associated protein 4 (Ckap4), partial
products short name :
[Cytoskeleton-associated protein 4 (Ckap4)]
other names :
[cytoskeleton-associated protein 4; Cytoskeleton-associated protein 4; cytoskeleton-associated protein 4; cytoskeleton-associated protein 4; 63-kDa cytoskeleton-linking membrane protein; Climp-63; p63]
products gene name :
[Ckap4]
products gene name syn :
[Ckap4]
other gene names :
[Ckap4; Ckap4; P63; CLIMP-63; 5630400A09Rik; Climp-63; p63]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[109-575. Partial, provide the complete extracellular domain.]
sequence :
VLEEVQQVRRGHQDFSRQRDELGQGLQGVEQKVQSLQAT
FGTFESLLRNSQHKQDLTEKAVKEGESELNRISEVLQKL
QNEILKDLSDGIHVVKDARERDFTSLENTVEERLTELTK
SINDNIAIFTDVQKRSQKEINEVKMKVASLEESKGDRSQ
DVKTLKDAVKEVQASMMSRERDIEALKSSLQTMESDVYT
EVRELVSLKQEQQAFKQAADSERLALQALTEKLLRSEES
SSRLPEDIRRLEEELQQLKVGAHGSEEGAVFKDSKALEE
LQRQIEGLGARLQYVEDGVYSMQVASARHTESLESLLSK
SQEYEQRLAMLQEHVGNLGSSSDLASTVRSLGETQLALS
SDLKELKQSLGELPGTVESLQEQVLSLLSQDQAQAEGLP
PQDFLDRLSSLDNLKSSVSQVESDLKMLRTAVDSLVAYS
VKIETNENNLESAKGLLDDLRNDLDRLFLKVEKIHEKI
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Mus musculus (Mouse)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The Baculovirus, E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi acc num :
NP_780660.1
ncbi gb acc num :
NM_175451.1
ncbi mol weight :
63,692 Da
ncbi pathways :
Protein Processing In Endoplasmic Reticulum Pathway (167331); Protein Processing In Endoplasmic Reticulum Pathway (167190)
uniprot summary :
High-affinity epithelial cell surface receptor for APF.
size2 :
0.01 mg (Baculovirus)
size3 :
0.01 mg (Mammalian-Cell)
size5 :
0.02 mg (Baculovirus)
size6 :
0.02 mg (Mammalian-Cell)
size8 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size12 :
0.1 mg (Baculovirus)
size14 :
0.1 mg (Mammalian-Cell)
size16 :
0.5 mg (Baculovirus)
size19 :
1 mg (Baculovirus)