product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human LR3 Insulin Like Growth Factor-1
catalog :
MBS145082
quantity :
0.2 mg
price :
140 USD
more info or order :
product information
catalog number :
MBS145082
products type :
Recombinant Protein
products full name :
Recombinant Human LR3 Insulin Like Growth Factor-1
products short name :
LR3 Insulin Like Growth Factor-1
products name syn :
LR3 IGF1 Human; LR3 Insulin Like Growth Factor-1 Human Recombinant; R3 IGF1; R3 IGF-1; R3IGF1; R3IGF-1; LONG IGF1; LONG IGF-1; LONG R3 IGF1; LONG R3IGF1; LONG R3 IGF-1; LONG R3IGF-1; Long R3 IGF1
host :
E Coli
sequence :
DECCFRSCDLRRLEMYCAPLKPAKSA.
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFN
KPTGYGSSSRRAPQTGIV
purity :
Greater than 95.0% as determined by SDS-PAGE and HPLC.
form :
Lyophilized from a 0.2 um filtered concentrated solution in 1xPBS. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution the LR3 IGF1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less then 10ng/ml, corresponding to a specific activity of 100,000 units/mg.
products categories :
CYTOKINES AND GROWTH FACTORS; Growth Factors; Insulin-Like Growth Factor
products description :
Description: The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Recombinant Human LR3 Insulin Like Growth Factor-1 produced in E Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa. Introduction: IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues.
size1 :
0.2 mg
price1 :
140 USD
size2 :
0.5 mg
price2 :
195
size3 :
1 mg
price3 :
245
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!