protein

Recombinant Human LR3 Insulin Like Growth Factor-1

MBS145082

0.2 mg

140 USD

Recombinant Protein

Recombinant Human LR3 Insulin Like Growth Factor-1

LR3 Insulin Like Growth Factor-1

LR3 IGF1 Human; LR3 Insulin Like Growth Factor-1 Human Recombinant; R3 IGF1; R3 IGF-1; R3IGF1; R3IGF-1; LONG IGF1; LONG IGF-1; LONG R3 IGF1; LONG R3IGF1; LONG R3 IGF-1; LONG R3IGF-1; Long R3 IGF1

E Coli

DECCFRSCDLRRLEMYCAPLKPAKSA.
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFN
KPTGYGSSSRRAPQTGIV

Greater than 95.0% as determined by SDS-PAGE and HPLC.

Lyophilized from a 0.2 um filtered concentrated solution in 1xPBS. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution the LR3 IGF1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less then 10ng/ml, corresponding to a specific activity of 100,000 units/mg.

CYTOKINES AND GROWTH FACTORS; Growth Factors; Insulin-Like Growth Factor

Description: The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Recombinant Human LR3 Insulin Like Growth Factor-1 produced in E Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa. Introduction: IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues.

0.2 mg

140 USD

0.5 mg

195

1 mg

245