product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Probable serine carboxypeptidase CPVL
catalog :
MBS1449179
quantity :
0.01 mg (E-Coli)
price :
160 USD
more info or order :
image
image 1 :
MyBioSource MBS1449179 image 1
product information
catalog number :
MBS1449179
products type :
Recombinant Protein
products full name :
Recombinant Human Probable serine carboxypeptidase CPVL
products short name :
[Probable serine carboxypeptidase CPVL]
products name syn :
[Carboxypeptidase, vitellogenic-like; Vitellogenic carboxypeptidase-like protein; VCP-like protein; hVLP]
other names :
[probable serine carboxypeptidase CPVL; Probable serine carboxypeptidase CPVL; probable serine carboxypeptidase CPVL; carboxypeptidase, vitellogenic like; Carboxypeptidase, vitellogenic-like; Vitellogenic carboxypeptidase-like protein; VCP-like protein; hVLP]
products gene name :
[CPVL]
other gene names :
[CPVL; CPVL; HVLP; VLP; VCP-like protein; hVLP]
uniprot entry name :
CPVL_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[23-476aa; Full Length]
sequence length :
476
sequence :
LFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELS
LVGPFPGLNMKSYAGFLTVNKTYNSNLFFWFFPAQIQPE
DAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRD
FPWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARD
LYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLI
HSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQI
GLLDEKQKKYFQKQCHECIEHIRKQNWFEAFEILDKLLD
GDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLS
LPEVRQAIHVGNQTFNDGTIVEKYLREDTVQSVKPWLTE
IMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYK
KAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHILP
YDQPLRAFDMINRFIYGKGWDPYVG
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
products categories :
Cell Biology
products description :
May be involved in the digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation.
products references :
Cloning and characterization of CPVL, a novel serine carboxypeptidase, from human macrophages.Mahoney J.A., Ntolosi B., DaSilva R.P., Gordon S., McKnight A.J.Genomics 72:243-251(2001) Cloning of VCP-like protein expressed in human heart and placenta.Cho J.-J., Baik H.-H.The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y., Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.DNA Res. 12:117-126(2005) Human chromosome 7 DNA sequence and biology.Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.Science 300:767-772(2003)
ncbi gi num :
83641876
ncbi acc num :
NP_061902.2
ncbi gb acc num :
NM_019029.2
uniprot acc num :
Q9H3G5
ncbi mol weight :
67.9kD
ncbi summary :
The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. At least two alternatively spliced transcripts which encode the same protein have been observed. [provided by RefSeq, Jul 2008]
uniprot summary :
CPVL: May be involved in the digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation. Belongs to the peptidase S10 family. Protein type: Protease; Secreted, signal peptide; Secreted; EC 3.4.16.-. Chromosomal Location of Human Ortholog: 7p15.1. Molecular Function: serine carboxypeptidase activity. Biological Process: proteolysis involved in cellular protein catabolic process
size1 :
0.01 mg (E-Coli)
price1 :
160 USD
size2 :
0.05 mg (E-Coli)
price2 :
200
size3 :
0.1 mg (E-Coli)
price3 :
295
size4 :
0.2 mg (E-Coli)
price4 :
480
size5 :
0.5 mg (E-Coli)
price5 :
790
size6 :
1 mg (E-Coli)
price6 :
1215
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!