product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human E3 ubiquitin-protein ligase ZNRF3
catalog :
MBS1448216
quantity :
0.01 mg (E-Coli)
price :
110 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1448216
products type :
Recombinant Protein
products full name :
Recombinant Human E3 ubiquitin-protein ligase ZNRF3
products short name :
E3 ubiquitin-protein ligase ZNRF3
products name syn :
RING finger protein 203; Zinc/RING finger protein 3
other names :
E3 ubiquitin-protein ligase ZNRF3 isoform 1; E3 ubiquitin-protein ligase ZNRF3; E3 ubiquitin-protein ligase ZNRF3; zinc and ring finger 3; RING finger protein 203; Zinc/RING finger protein 3
products gene name :
ZNRF3
other gene names :
ZNRF3; ZNRF3; RNF203; BK747E2.3; KIAA1133; RNF203
uniprot entry name :
ZNRF3_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
56-219
sequence length :
936
sequence :
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSA
EGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDP
KPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGS
EDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPR
QPTEYFDM
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Epigenetics and Nuclear Signaling
products description :
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone.
products references :
Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45(2004)
ncbi gi num :
332801080
ncbi acc num :
NP_001193927.1
ncbi gb acc num :
NM_001206998.1
uniprot acc num :
Q9ULT6
ncbi mol weight :
34.17kD
ncbi pathways :
Regulation Of FZD By Ubiquitination Pathway (1269607); Signal Transduction Pathway (1269379); Signaling By Wnt Pathway (1269594); TCF Dependent Signaling In Response To WNT Pathway (1269599)
uniprot summary :
ZNRF3: E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non- canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Belongs to the ZNRF3 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: EC 6.3.2.19; Ubiquitin conjugating system; Membrane protein, integral; Ubiquitin ligase; EC 6.3.2.-. Chromosomal Location of Human Ortholog: 22q12.1. Cellular Component: integral to plasma membrane; plasma membrane. Molecular Function: frizzled binding; ligase activity; protein binding; ubiquitin-protein ligase activity; zinc ion binding. Biological Process: protein ubiquitination; ubiquitin-dependent protein catabolic process; Wnt receptor signaling pathway through beta-catenin; Wnt receptor signaling pathway, planar cell polarity pathway
size1 :
0.01 mg (E-Coli)
price1 :
110 USD
size2 :
0.05 mg (E-Coli)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.5 mg (E-Coli)
price4 :
750
size5 :
0.05 mg (Baculovirus)
price5 :
905
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!