catalog number :
MBS1444441
products type :
Recombinant Protein
products full name :
Recombinant Human T-cell immunoreceptor with Ig and ITIM domains
products short name :
T-cell immunoreceptor with Ig and ITIM domains
products name syn :
V-set and immunoglobulin domain-containing protein 9; V-set and transmembrane domain-containing protein 3
other names :
T-cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domains; V-set and immunoglobulin domain-containing protein 9; V-set and transmembrane domain-containing protein 3
products gene name :
TIGIT
other gene names :
TIGIT; TIGIT; VSIG9; VSTM3; WUCAM; VSIG9; VSTM3
uniprot entry name :
TIGIT_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-141, Fragment at the N-terminal, provide the complete extracellular domain.
sequence :
MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWE
QQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLT
VNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARF
QIP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Immunology
products description :
Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells.
products references :
The surface protein TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells."
Yu X., Harden K., Gonzalez L.C., Francesco M., Chiang E., Irving B., Tom I., Ivelja S., Refino C.J., Clark H., Eaton D., Grogan J.L.
Nat. Immunol. 10:48-57(2009)
ncbi acc num :
NP_776160.2
ncbi gb acc num :
NM_173799.3
ncbi mol weight :
18,432 Da
ncbi pathways :
Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480)
ncbi summary :
This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.[provided by RefSeq, Sep 2009]
size4 :
0.05 mg (Baculovirus)
size5 :
0.05 mg (Mammalian-Cell)