Recombinant Human Membrane-bound transcription factor site-1 protease (MBTPS1), partial | MyBioSource MBS1443067 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Membrane-bound transcription factor site-1 protease (MBTPS1), partial

catalog :

MBS1443067

quantity :

0.01 mg (E-Coli)

price :

200 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1443067

products type :

Recombinant Protein

products full name :

Recombinant Human Membrane-bound transcription factor site-1 protease (MBTPS1), partial

products short name :

[Membrane-bound transcription factor site-1 protease (MBTPS1), partial]

products name syn :

[Membrane-bound transcription factor site-1 protease; EC=3.4.21.112; Endopeptidase S1P; Subtilisin/kexin-isozyme 1; SKI-1]

other names :

[membrane-bound transcription factor site-1 protease preproprotein; Membrane-bound transcription factor site-1 protease; membrane-bound transcription factor site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1; proprotein convertase subtilisin/kexin type 8; membrane-bound transcription factor peptidase, site 1; Endopeptidase S1P; Subtilisin/kexin-isozyme 1; SKI-1]

products gene name :

[MBTPS1]

products gene name syn :

[MBTPS1; KIAA0091; S1P; SKI1]

other gene names :

[MBTPS1; MBTPS1; S1P; PCSK8; SKI-1; KIAA0091; S1P; SKI1; SKI-1]

uniprot entry name :

MBTP1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[218-414aa; Partial]

sequence :

DTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGV
IASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNY
AILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVS
AIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSR
GMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSG
TS

purity :

>=90%

form :

Liquid containing glycerol

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

image1 heading :

SDS-PAGE

other info1 :

Species: Homo sapiens (Human)

products categories :

Epigenetics and Nuclear Signaling

products description :

Serine protease that catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF, GNPTAB and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu. Mediates the protein cleavage of GNPTAB into subunit alpha and beta, thereby participating in biogenesis of lysosomes.

ncbi gi num :

4506775

ncbi acc num :

NP_003782.1

ncbi gb acc num :

NM_003791.3

uniprot acc num :

Q14703

ncbi mol weight :

117,749 Da

ncbi pathways :

Activation Of Chaperones By ATF6-alpha Pathway (105905); Metabolism Pathway (477135); Metabolism Of Lipids And Lipoproteins Pathway (160976); Metabolism Of Proteins Pathway (106230); Protein Processing In Endoplasmic Reticulum Pathway (167325); Protein Processing In Endoplasmic Reticulum Pathway (167190); Regulation Of Cholesterol Biosynthesis By SREBP (SREBF) Pathway (685551); SREBP Signalling Pathway (219802); Unfolded Protein Response Pathway (105904)

ncbi summary :

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction. [provided by RefSeq, Feb 2014]

uniprot summary :

MBTPS1: Catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His- Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu. Belongs to the peptidase S8 family. Protein type: Endoplasmic reticulum; EC 3.4.21.112; Protease; Membrane protein, integral. Chromosomal Location of Human Ortholog: 16q24. Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; Golgi stack; endoplasmic reticulum lumen; integral to membrane. Molecular Function: serine-type endopeptidase activity. Biological Process: cholesterol metabolic process; regulation of transcription factor import into nucleus; unfolded protein response, activation of signaling protein activity; membrane protein intracellular domain proteolysis; cellular protein metabolic process; unfolded protein response; lysosome organization and biogenesis; lipid metabolic process; proteolysis

size1 :

0.01 mg (E-Coli)

price1 :

200 USD

size2 :

0.05 mg (E-Coli)

price2 :

260

size3 :

0.1 mg (E-Coli)

price3 :

430

size4 :

0.2 mg (E-Coli)

price4 :

685

size5 :

0.5 mg (E-Coli)

price5 :

1125

size6 :

1 mg (E-Coli)

price6 :

1725

more info or order :

MyBioSource product webpage