Recombinant Human Protein FAM20A | MyBioSource MBS1442497 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Protein FAM20A

catalog :

MBS1442497

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1442497

products type :

Recombinant Protein

products full name :

Recombinant Human Protein FAM20A

products short name :

FAM20A

other names :

pseudokinase FAM20A isoform b; Pseudokinase FAM20A; pseudokinase FAM20A; family with sequence similarity 20 member A

products gene name :

FAM20A

other gene names :

FAM20A; FAM20A; AI1G; AIGFS; FP2747

uniprot entry name :

FA20A_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

34-541

sequence length :

403

sequence :

QLRPRERPRGCPCTGRASSLARDSAAAASDPGTIVHNFS
RTEPRTEPAGGSHSGSSSKLQALFAHPLYNVPEEPPLLG
AEDSLLASQEALRYYRRKVARWNRRHKMYREQMNLTSLD
PPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMR
HFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRF
SDFGKAMFKPMRQQRDEETPVDFFYFIDFQRHNAEIAAF
HLDRILDFRRVPPTVGRIVNV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cell Biology

products references :

Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) FAM20 an evolutionarily conserved family of secreted proteins expressed in hematopoietic cells.Nalbant D., Youn H., Nalbant S.I., Sharma S., Cobos E., Beale E.G., Du Y., Williams S.C.BMC Genomics 6:11-11(2005) Whole-exome sequencing identifies FAM20A mutations as a cause of amelogenesis imperfecta and gingival hyperplasia syndrome.O'Sullivan J., Bitu C.C., Daly S.B., Urquhart J.E., Barron M.J., Bhaskar S.S., Martelli-Junior H., dos Santos Neto P.E., Mansilla M.A., Murray J.C., Coletta R.D., Black G.C., Dixon M.J.Am. J. Hum. Genet. 88:616-620(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Novel FAM20A mutations in hypoplastic amelogenesis imperfecta.Cho S.H., Seymen F., Lee K.E., Lee S.K., Kweon Y.S., Kim K.J., Jung S.E., Song S.J., Yildirim M., Bayram M., Tuna E.B., Gencay K., Kim J.W.Hum. Mutat. 33:91-94(2012) Nephrocalcinosis (enamel renal syndrome) caused by autosomal recessive FAM20A mutations.Jaureguiberry G., De la Dure-Molla M., Parry D., Quentric M., Himmerkus N., Koike T., Poulter J., Klootwijk E., Robinette S.L., Howie A.J., Patel V., Figueres M.L., Stanescu H.C., Issler N., Nicholson J.K., Bockenhauer D., Laing C., Walsh S.B., McCredie D.A., Povey S., Asselin A., Picard A., Coulomb A., Medlar A.J., Bailleul-Forestier I., Verloes A., Le Caignec C., Roussey G., Guiol J., Isidor B., Logan C., Shore R., Johnson C., Inglehearn C., Al-Bahlani S., Schmittbuhl M., Clauss F., Huckert M., Laugel V., Ginglinger E., Pajarola S., Sparta G., Bartholdi D., Rauch A., Addor M.C., Yamaguti P.M., Safatle H.P., Acevedo A.C., Martelli-Junior H., dos Santos Netos P.E., Coletta R.D., Gruessel S., Sandmann C., Ruehmann D., Langman C.B., Scheinman S.J., Ozdemir-Ozenen D., Hart T.C., Hart P.S., Neugebauer U., Schlatter E., Houillier P., Gahl W.A., Vikkula M., Bloch-Zupan A., Bleich M., Kitagawa H., Unwin R.J., Mighell A., Berdal A., Kleta R.Nephron Physiol. 122:1-6(2012) FAM20A mutations can cause enamel-renal syndrome (ERS) .Wang S.K., Aref P., Hu Y., Milkovich R.N., Simmer J.P., El-Khateeb M., Daggag H., Baqain Z.H., Hu J.C.PLoS Genet. 9:E1003302-E1003302(2013) FAM20A mutations associated with enamel renal syndrome.Wang S.K., Reid B.M., Dugan S.L., Roggenbuck J.A., Read L., Aref P., Taheri A.P., Yeganeh M.Z., Simmer J.P., Hu J.C.J. Dent. Res. 93:42-48(2014)

ncbi gi num :

344198227

ncbi acc num :

NP_001230675.1

ncbi gb acc num :

NM_001243746.1

uniprot acc num :

Q96MK3

ncbi mol weight :

59.6kD

ncbi summary :

This locus encodes a protein that is likely secreted and may function in hematopoiesis. A mutation at this locus has been associated with amelogenesis imperfecta and gingival hyperplasia syndrome. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011]

uniprot summary :

FAM20A: Defects in FAM20A are the cause of amelogenesis imperfecta and gingival fibromatosis syndrome (AIGFS). An autosomal recessive condition characterized by mild gingival fibromatosis and dental anomalies, including hypoplastic amelogenesis imperfecta, intrapulpal calcifications, delay of tooth eruption, hypodontia/oligodontia, pericoronal radiolucencies, and unerupted teeth. Belongs to the FAM20 family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 17q24.2. Cellular Component: cell; endoplasmic reticulum; Golgi apparatus. Molecular Function: protein binding; protein serine/threonine kinase activator activity; protein serine/threonine kinase activity. Biological Process: biomineral formation; calcium ion homeostasis; positive regulation of protein amino acid phosphorylation. Disease: Amelogenesis Imperfecta, Type Ig

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1295

more info or order :

MyBioSource product webpage