catalog number :
MBS143878
products type :
Recombinant Protein
products full name :
Recombinant Human Tumor Necrosis Factor Receptor Type His Tag
products short name :
Tumor Necrosis Factor Receptor Type
products name syn :
TNFR Human, His; Tumor Necrosis Factor Receptor Type Human Recombinant, His Tag; Tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor 1; Tumor necrosis factor receptor type I; TNF-R1; TNF-RI; TNFR-I; p60; p55; CD120a; TNFRSF1A; TNFAR; TNFR1; FPF; TBP1; TNF-R; p55-R; TNFR55; TNFR60; TNF-R-I; TNF-R55; MGC19588; TNFR His
other names :
tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor superfamily member 1A; tumor necrosis factor receptor superfamily member 1A; TNF-R1; TNF-RI; TNFR-I; tumor necrosis factor binding protein 1; tumor necrosis factor receptor 1A isoform beta; tumor necrosis factor receptor type 1; tumor necrosis factor-alpha receptor; tumor necrosis factor receptor superfamily, member 1A; Tumor necrosis factor receptor 1; TNF-R1; Tumor necrosis factor receptor type I; TNF-RI; TNFR-I; p55; p60; CD_antigen: CD120aCleaved into the following 2 chains:Tumor necrosis factor receptor superfamily member 1A, membrane form; Tumor necrosis factor-binding protein 1; TBPI
products gene name :
TNFR
other gene names :
TNFRSF1A; TNFRSF1A; FPF; MS5; p55; p60; TBP1; TNF-R; TNFAR; TNFR1; p55-R; CD120a; TNFR55; TNFR60; TNF-R-I; TNF-R55; TNFR1-d2; TNFAR; TNFR1; TNF-R1; TNF-RI; TNFR-I; TBPI
uniprot entry name :
TNR1A_HUMAN
sequence :
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDT
DCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCT
VDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLS
CQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCL
PQIEN.
purity :
Greater than 95.0% as determined by SDS-PAGE.
form :
TNFR His Tag protein is supplied in 1xPBS, 50% glycerol. Sterile Filtered clear solution.
storage stability :
Store at 4 degree C if entire vial will be used within 2-4 weeks. Store, frozen at -20 degree C for longer periods of time. Please avoid freeze thaw cycles.
products categories :
CYTOKINES AND GROWTH FACTORS; Cytokines; Tumor Necrosis Factor
products description :
Description: TNFR Human Recombinant produced in E Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques. Introduction: TNFR1 belongs to the TNF-receptor superfamily. TNFR1 is a receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. There are 2 types of soluble TNF receptors: sTNFR-I and sTNFR-II, which act to neutralize the biological activities of TNF alpha and TNF beta. The levels of these soluble receptors seem to increase as a result of shedding of the extracellular domains of the membrane bound receptors. TNF-a, TNFR1 and TNFR2 have roles in cellular differentiation. TNFR1 and TNFR2 function in cell type-specific renal injury.TNFR1 is capable of signaling both cell survival and apoptosis. TNFR1-induced apoptosis requires 2 sequential signaling complexes. TNFR1 is capable of activating NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Oxidative stress promotes TNFR1 and TNFR2 self-interaction, ligand-independent and enhanced ligand-dependent TNF signaling. TNFR1 contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. Human TNFR1 has a major region which controls cell surface expression. High levels of soluble TNF receptors are found in the amniotic fluid of pregnant women.Germline mutations of the extracellular domains of TNFR1 are linked to the autosomal dominant periodic fever syndrome. The impaired receptor clearance is believed to be a mechanism of the disease. Familial hibernian fever (FHF) is caused by defects in TNFRSF1A gene.
ncbi acc num :
NP_001056.1
ncbi gb acc num :
NM_001065.3
ncbi mol weight :
24,194 Da
ncbi pathways :
Adipocytokine Signaling Pathway 83093!!Adipocytokine Signaling Pathway 505!!Alzheimer's Disease Pathway 83097!!Alzheimer's Disease Pathway 509!!Alzheimers Disease Pathway 672448!!Amyotrophic Lateral Sclerosis (ALS) Pathway 920975!!Amyotrophic Lateral Sclerosis (ALS) Pathway 83099!!Amyotrophic Lateral Sclerosis (ALS) Pathway 511!!Apoptosis Pathway 198797!!Apoptosis Pathway 83060
ncbi summary :
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq, Jul 2008]