catalog number :
MBS1438331
products type :
Recombinant Protein
products full name :
Recombinant Mouse 2-oxoglutarate dehydrogenase, mitochondrial
products short name :
2-oxoglutarate dehydrogenase
products name syn :
2-oxoglutarate dehydrogenase complex component E1; OGDC-E1; Alpha-ketoglutarate dehydrogenase
other names :
2-oxoglutarate dehydrogenase, mitochondrial isoform 1; 2-oxoglutarate dehydrogenase, mitochondrial; 2-oxoglutarate dehydrogenase, mitochondrial; oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide); 2-oxoglutarate dehydrogenase complex component E1; OGDC-E1; Alpha-ketoglutarate dehydrogenase
products gene name :
Ogdh
other gene names :
Ogdh; Ogdh; d1401; AA409584; mKIAA4192; 2210403E04Rik; 2210412K19Rik; Kiaa4192; OGDC-E1
uniprot entry name :
ODO1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
705-1023
sequence :
VDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFA
MASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQ
NGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPD
LQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPF
RKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENG
PAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAIT
RIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYD
YVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTEL
QRFLDTAFDLDAFKKFS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products categories :
Metabolism
products description :
The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
products references :
Prediction of the coding sequences of mouse homologues of KIAA gene. The complete nucleotide sequences of mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Nagase T., Ohara O., Koga H.
Submitted (FEB-2005)
ncbi acc num :
NP_001239211.1
ncbi gb acc num :
NM_001252282.1
ncbi mol weight :
53.84kD
ncbi pathways :
2-amino-3-carboxymuconate Semialdehyde Degradation To Glutaryl-CoA Pathway (143014); 2-ketoglutarate Dehydrogenase Complex Pathway (142965); Amino Acid Metabolism Pathway (198416); Carbon Metabolism Pathway (815838); Carbon Metabolism Pathway (817567); Citrate Cycle (TCA Cycle) Pathway (83127); Citrate Cycle (TCA Cycle) Pathway (288); Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway (855821); Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway (468202); Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate = Oxaloacetate Pathway (421748)
uniprot summary :
OGDH: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components: 2- oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3). Belongs to the alpha-ketoglutarate dehydrogenase family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Amino Acid Metabolism - lysine degradation; Amino Acid Metabolism - tryptophan; Carbohydrate Metabolism - citrate (TCA) cycle; Mitochondrial; Oxidoreductase; EC 1.2.4.2. Cellular Component: mitochondrion; oxoglutarate dehydrogenase complex. Molecular Function: chaperone binding; heat shock protein binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor; oxoglutarate dehydrogenase (succinyl-transferring) activity; thiamin pyrophosphate binding. Biological Process: 2-oxoglutarate metabolic process; glycolysis; metabolic process; NADH metabolic process; succinyl-CoA metabolic process; tricarboxylic acid cycle
size4 :
0.05 mg (Baculovirus)