product summary
request information :
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Ciliary Neurotrophic Factor
catalog :
MBS143807
quantity :
1 mg
price :
2665 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS143807
products type :
Recombinant Protein
products full name :
Recombinant Rat Ciliary Neurotrophic Factor
products short name :
Ciliary Neurotrophic Factor
products name syn :
CNTF Rat; Ciliary Neurotrophic Factor Rat Recombinant; HCNTF; CNTF; Ciliary Neurotrophic Factor
other names :
ciliary neurotrophic factor; Ciliary neurotrophic factor; ciliary neurotrophic factor; ciliary neurotropic factor; ciliary neurotrophic factor; N/A
products gene name :
rCNTF
other gene names :
Cntf; Cntf; CNTF
uniprot entry name :
CNTF_RAT
host :
E Coli
sequence length :
200
sequence :
HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINL
DSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTK
LLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMV
LLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQ
WTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
AFAEQTPLTL
purity :
Greater than 99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
form :
Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CNTF should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100 ug/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. Biological Activity: Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
products categories :
CYTOKINES AND GROWTH FACTORS; Neurotrophins; Ciliary-Neurotrophic Factor
products description :
Description: CNTF Recombinant Rat produced in E Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques. Introduction: CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. In addition to the predominant monocistronic transcript originating from this locus, the gene is also co-transcribed with the upstream ZFP91 gene. Co-transcription from the two loci results in a transcript that contains a complete coding region for the zinc finger protein but lacks a complete coding region for ciliary neurotrophic factor.CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
ncbi gi num :
6978675
ncbi acc num :
NP_037298.1
ncbi gb acc num :
NM_013166.1
uniprot acc num :
P20294
ncbi mol weight :
22,854 Da
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway 83443!!Cytokine-cytokine Receptor Interaction Pathway 460!!Delta-Notch Signaling Pathway 198480!!Jak-STAT Signaling Pathway 83469!!Jak-STAT Signaling Pathway 488
ncbi summary :
a cytokine involved in neuronal degeneration and adipocyte gene expression [RGD, Feb 2006]
size :
1 mg
price :
2665 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!