protein

Recombinant Human Tumor Necrosis Factor Receptor Type 2, His Tag

MBS143765

0.02 mg

205 USD

Recombinant Protein

Recombinant Human Tumor Necrosis Factor Receptor Type 2, His Tag

Tumor Necrosis Factor Receptor Type 2

TNFR2 Human, His; Tumor Necrosis Factor Receptor Type 2 Human Recombinant, His Tag; Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor type II; p75; p80 TNF-alpha receptor; CD120b; Etanercept; TNF-R2; TNF-RII; TNFR-II; TNFRSF1B; TNFBR; TNFR2; TBPII; TNFR2; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II; TNFR2 His

tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor superfamily member 1B; tumor necrosis factor receptor superfamily member 1B; TNF-R2; TNF-RII; p75 TNF receptor; p80 TNF-alpha receptor; soluble TNFR1B variant 1; tumor necrosis factor beta receptor; tumor necrosis factor binding protein 2; tumor necrosis factor receptor 2; tumor necrosis factor receptor type II; tumor necrosis factor receptor superfamily, member 1B; Tumor necrosis factor receptor 2; TNF-R2; Tumor necrosis factor receptor type II; TNF-RII; TNFR-II; p75; p80 TNF-alpha receptor; CD_antigen: CD120b; INN: EtanerceptCleaved into the following 2 chains:Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2Alternative name(s):TBP-2; TBPII

TNFR2

TNFRSF1B; TNFRSF1B; p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II; TNFBR; TNFR2; TNF-R2; TNF-RII; TNFR-II

TNR1B_HUMAN

E Coli

461

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQ
HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRC
SSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAP
LRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDI
CRPHQICNVVAIPGNASMDAVCTSTSPT.

Greater than 95.0% as determined by SDS-PAGE.

TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol. Sterile Filtered clear solution.

Store at 4 degree C if entire vial will be used within 2-4 weeks. Store, frozen at -20 degree C for longer periods of time. Please avoid freeze thaw cycles.

CYTOKINES AND GROWTH FACTORS; Cytokines; Tumor Necrosis Factor

Description: TNFR2 Human Recombinant produced in E Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR2 is purified by proprietary chromatographic techniques. Introduction: TNFR2 belongs to the TNF-receptor superfamily. TNFR2 is receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. TNFR2 mediates the majority of the metabolic effects of TNF-alpha. In addition, knockout studies in mice propose a role for TNFR2 in protecting neurons from apoptosis by stimulating antioxidative pathways. TNFR2 expression might have a significant role in the angiogenesis, tumor cell proliferation and metastasis of Invasive micropapillary carcinoma of the breast.There are 2 types of soluble TNF receptors: sTNFR-I and sTNFR-II, which act to neutralize the biological activities of TNF alpha and TNF beta. The levels of these soluble receptors seem to increase as a result of shedding of the extracellular domains of the membrane bound receptors. High levels of soluble TNF receptors are found in the amniotic fluid of pregnant women. TNFR2 and TNFR1 form a heterocomplex which mediates the recruitment of 2 anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. IAPs' function in TNF-receptor signaling is unknown; nevertheless, c-IAP1 is believed to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Oxidative stress promotes TNFR1 and TNFR2 self-interaction, ligand-independent and enhanced ligand-dependent TNF signaling. TNF-a, TNFR1 and TNFR2 have roles in cellular differentiation. TNFR1 and TNFR2 function in cell type-specific renal injury.

4507577

NP_001057.1

NM_001066.2

P20333

28,461 Da

Adipocytokine Signaling Pathway 83093!!Adipocytokine Signaling Pathway 505!!Amyotrophic Lateral Sclerosis (ALS) Pathway 83099!!Amyotrophic Lateral Sclerosis (ALS) Pathway 511!!Apoptosis Pathway 198797!!Apoptosis Modulation And Signaling Pathway 198822!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!IL-3 Signaling Pathway 198881!!Inflammatory Response Pathway 198766

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq, Jul 2008]

0.02 mg

205 USD