product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Streptavidin
catalog :
MBS143744
quantity :
5 mg
price :
140 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS143744
products type :
Recombinant Protein
products full name :
Recombinant Streptavidin
products short name :
Streptavidin
products name syn :
Streptavidin; Streptavidin Recombinant; Streptavidin
other names :
Streptavidin; Streptavidin
uniprot entry name :
SAV_STRAV
host :
E Coli
sequence length :
183
sequence :
MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA
ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSA
TTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHD
TFTKVKPSAAS.
purity :
Greater than 98.0% as determined by SDS-PAGE and RP-HPLC.
form :
Lyophilized in 10mM potassium phosphate buffer pH 6.5. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Streptavidin is shipped at ambient temperature, upon arrival store at -20 degree C.
other info1 :
Specific Activity: > 17U/mg (one unit binds 1 ug D-biotin at pH 8.9). Proteolytic Activity: <10^-3 U/mg protein (Azocoll, 25 degree C, 24h, pH8.0).
other info2 :
Solubility: It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
products categories :
RECOMBINANT & NATURAL PROTEINS; Recombinant Proteins; Streptavidin
products description :
Description: Streptavidin Streptomyces Avidinii Recombinant produced in E Coli. The molecular weight per tetramer is approximately 52kDa. Introduction: Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.
ncbi gi num :
134951
ncbi acc num :
P22629.1
uniprot acc num :
P22629
ncbi mol weight :
52kDa
uniprot summary :
streptavidin: The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). (organism: Streptomyces avidinii)
size1 :
5 mg
price1 :
140 USD
size2 :
20 mg
price2 :
205
size3 :
1 g
price3 :
3205
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!