product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Trypsin, Yeast
catalog :
MBS143725
quantity :
1 mg
price :
140 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS143725
products type :
Recombinant Protein
products full name :
Recombinant Human Trypsin, Yeast
products short name :
Trypsin
products name syn :
Trypsin Human, Yeast; Trypsin Human Recombinant, Yeast; Trypsin Yeast
other names :
AGAP008296-PA; Trypsin-1; AGAP008296-PA; Antryp1
other gene names :
TRY1_ANOGA; TRYP1
uniprot entry name :
TRY1_ANOGA
host :
Pichia Pastoris
sequence length :
274
sequence :
VRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRA VINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAP VLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQ GVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS.
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAG
HCYKSRIQ
form :
The protein is formulated with 1mM HCl and 20mM CaCl2, pH-3. Sterile Filtered clear liquid solution.
storage stability :
Recombinant Human Trypsin should be stored at 2-8 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
other info2 :
Biological Activity: 2,500 BAEE units/mg powder.
products categories :
RECOMBINANT & NATURAL PROTEINS; Recombinant Proteins; Trypsin
products description :
Description: Recombinant Human Trypsin is free from any animal and human sources. Recombinant Human Trypsin expressed in Yeast and purified by standard chromatography techniques. Recombinant Human Trypsin is free from foreign enzymes such as carboxypeptidase A & chymotrypsin. Recombinant Human Trypsin is free from protease inhibitors such as PMSF and EDTA. Introduction: Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-alpha-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
ncbi gi num :
58389638
ncbi acc num :
XP_317170.2
ncbi gb acc num :
XM_317170.2
ncbi mol weight :
29,057 Da
ncbi pathways :
Neuroactive Ligand-receptor Interaction Pathway 119400!!Neuroactive Ligand-receptor Interaction Pathway 462
size :
1 mg
price :
140 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!