product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Leukemia Inhibitory Factor
catalog :
MBS143714
quantity :
0.01 mg
price :
205 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS143714
products type :
Recombinant Protein
products full name :
Recombinant Mouse Leukemia Inhibitory Factor
products short name :
Leukemia Inhibitory Factor
products name syn :
LIF Mouse; Leukemia Inhibitory Factor Mouse Recombinant; CDF; HILDA; D-FACTOR; Differentiation- stimulating factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin; Leukemia inhibitory factor; LIF; DIA
other names :
leukemia inhibitory factor isoform b; Leukemia inhibitory factor; leukemia inhibitory factor; d factor; differentiation-stimulating factor; leukemia inhibitory factor; Differentiation-stimulating factor; D factor
products gene name :
mLIF
other gene names :
Lif; Lif; LIF; D factor
uniprot entry name :
LIF_MOUSE
host :
E Coli
sequence length :
158
sequence :
NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.
MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSAN
ALFISYYTAQGEPFP
purity :
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be < 0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg.A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.
products categories :
CYTOKINES AND GROWTH FACTORS; Cytokines; Leukemia Inhibitory Factor
products description :
Description: Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques. Introduction: Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence.
ncbi gi num :
88014736
ncbi acc num :
NP_001034626.1
ncbi gb acc num :
NM_001039537.2
uniprot acc num :
P09056
ncbi mol weight :
22,287 Da
ncbi pathways :
Adipogenesis Pathway 198299!!Cytokine-cytokine Receptor Interaction Pathway 83248!!Cytokine-cytokine Receptor Interaction Pathway 460!!ESC Pluripotency Pathways 198374!!Jak-STAT Signaling Pathway 83274!!Jak-STAT Signaling Pathway 488!!MicroRNAs In Cardiomyocyte Hypertrophy Pathway 198337!!PluriNetWork Pathway 198307!!Signaling Pathways Regulating Pluripotency Of Stem Cells 1026143!!Signaling Pathways Regulating Pluripotency Of Stem Cells 1033502
size :
0.01 mg
price :
205 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!