product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Matrix Metalloproteinase-9
catalog :
MBS143703
quantity :
0.01 mg
price :
205 USD
more info or order :
product information
catalog number :
MBS143703
products type :
Recombinant Protein
products full name :
Recombinant Human Matrix Metalloproteinase-9
products short name :
Matrix Metalloproteinase-9
products name syn :
MMP 9 Human; Matrix Metalloproteinase-9 Human Recombinant; Matrix metalloproteinase-9; MMP-9; 92 kDa type IV collagenase; 92 kDa gelatinase; Gelatinase B; GELB; MMP9; CLG4B
other names :
matrix metalloproteinase-9 preproprotein; Matrix metalloproteinase-9; matrix metalloproteinase-9; macrophage gelatinase; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); type V collagenase; matrix metallopeptidase 9; 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; GELB
products gene name :
MMP 9
other gene names :
MMP9; MMP9; GELB; CLG4B; MMP-9; MANDP2; CLG4B; MMP-9; GELB
uniprot entry name :
MMP9_HUMAN
host :
E Coli
sequence length :
707
sequence :
Tag-DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFAL
WSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDG
LLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNA
DGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDT
DDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACT
TDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNS
AGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDS
DKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGP.
4.5kDa His
purity :
Greater than 95.0% as determined by SDS-PAGE.
form :
(0.57 mg/ml) MMP-9 protein is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol. Sterile Filtered clear solution.
storage stability :
Store at 4 degree C if entire vial will be used within 2-4 weeks. Store, frozen at -20 degree C for longer periods of time. Please avoid freeze thaw cycles.
products categories :
ENZYMES; Enzymes; Matrix Metalloproteinase
products description :
Description: MMP-9 Human Recombinant produced in E Coli is single, a non-glycosylated, Polypeptide chain containing 338 amino acids fragment (113-450) corresponding to the catalytic domain of the protein, having a total molecular mass of 42.03kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The MMP-9 is purified by proprietary chromatographic techniques. Introduction: Matrix metalloproteinases are a family of zinc and calcium-dependent endopeptidases that break down extracellular matrix proteins. The MMP9 is secreted as a 92kDa zymogen. Cleavage of ProMMP-9 results in the active enzyme, having a molecular weight of approximately 82kDa. MMP9 is composed of the following domains: a gelatin-binding domain consisting of three fibronectin type II units, a catalytic domain containing the zinc-binding site, a proline-rich type V collagen-homologous domain and a hemopexin-like domain. MMP9 is produced by the several cell types: monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts and endothelial cells. MMP9 is involved in inflammatory responses, tissue remodeling, wound healing, tumor growth and metastasis. MMP9 may also play an important part in local proteolysis of the extracellular matrix and in leukocyte migration, as well as in bone osteoclastic resorption. MMP9 cleaves type IV and type V collagens into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. MMP9 can also degrade fibronectin but not laminin or Pz-peptide.MMP9 defects may be a cause of susceptibility to intervertebral disc disease (IDD), also known as lumbar disk herniation (LDH).
ncbi gi num :
74272287
ncbi acc num :
NP_004985.2
ncbi gb acc num :
NM_004994.2
uniprot acc num :
P14780
ncbi mol weight :
78,458 Da
ncbi pathways :
AGE/RAGE Pathway 698754!!Activation Of Matrix Metalloproteinases Pathway 576264!!Angiogenesis Pathway 198772!!Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway 730306!!Axon Guidance Pathway 105688!!Bladder Cancer Pathway 83115!!Bladder Cancer Pathway 527!!CXCR4-mediated Signaling Events Pathway 137910!!Collagen Degradation Pathway 730309!!Collagen Formation Pathway 645288
ncbi summary :
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. [provided by RefSeq, Jul 2008]
size :
0.01 mg
price :
205 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!