catalog number :
MBS143606
products type :
Recombinant Protein
products full name :
Recombinant Human Hepatocyte Growth Factor B Chain
products short name :
Hepatocyte Growth Factor B Chain
products name syn :
HGF B Human; Hepatocyte Growth Factor B Chain Human Recombinant; Scatter Factor; SF; Hepatopoietin; HPTA; HGF; HGFB; F-TCF; DFNB39; Hepatocyte growth factor; Hepatocyte growth factor beta chain
other names :
hepatocyte growth factor isoform 1 preproprotein; Hepatocyte growth factor; hepatocyte growth factor; fibroblast-derived tumor cytotoxic factor; hepatopoeitin-A; hepatopoietin-A; lung fibroblast-derived mitogen; hepatocyte growth factor (hepapoietin A; scatter factor); Hepatopoietin-A; Scatter factor; SF
products gene name :
HGF-B
other gene names :
HGF; HGF; SF; HGFB; HPTA; F-TCF; DFNB39; HPTA; SF
uniprot entry name :
HGF_HUMAN
sequence :
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR
QCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVY
GPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTS
CSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKV
TLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLG
VIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
.
purity :
Greater than 95.0% as determined by SDS-PAGE.
form :
HGF-B protein is supplied in 1xPBS, 50% glycerol. Sterile Filtered clear solution.
storage stability :
Store at 4 degree C if entire vial will be used within 2-4 weeks. Store, frozen at -20 degree C for longer periods of time. Please avoid freeze thaw cycles.
products categories :
CYTOKINES AND GROWTH FACTORS; Growth Factors; Hepatocyte Growth Factor
products description :
Description: HGF-B Human Recombinant produced in E Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The HGF-B is purified by proprietary chromatographic techniques. Introduction: Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulate colony formation of hematopoietic progenitor cells in vitro and may, therefore, also modulate hematopoiesis. HGF is secreted as a single inactive polypeptide which is cleaved by serine proteases into a 69kDa Alpha chain and 34kDa Beta chain. A disulfide bond linking the alpha and beta chains produces the active heterodimeric molecule.
ncbi acc num :
NP_000592.3
ncbi gb acc num :
NM_000601.4
ncbi mol weight :
24,116 Da
ncbi pathways :
Arf6 Signaling Events Pathway 138034!!Cytokine Signaling In Immune System Pathway 366171!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Direct P53 Effectors Pathway 137939!!FGF Signaling Pathway 137989!!Focal Adhesion Pathway 198795!!Focal Adhesion Pathway 83067!!Focal Adhesion Pathway 478!!Hemostasis Pathway 106028
ncbi summary :
Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]