Recombinant Human Trefoil Factor-1 | MyBioSource MBS143342 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Trefoil Factor-1

catalog :

MBS143342

quantity :

0.005 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS143342

products type :

Recombinant Protein

products full name :

Recombinant Human Trefoil Factor-1

products short name :

Trefoil Factor-1

products name syn :

TFF1 Human; Trefoil Factor-1 Human Recombinant; TFF-1; TFF1; pS2; BCEI; HPS; HP1.A; pNR-2; D21S21; pS2 protein; Trefoil factor 1; Breast cancer estrogen-inducible protein

other names :

trefoil factor 1; Trefoil factor 1; trefoil factor 1; breast cancer estrogen-inducible protein; breast cancer estrogen-inducible sequence; gastrointestinal trefoil protein pS2; polypeptide P1.A; trefoil factor 1; Breast cancer estrogen-inducible protein; PNR-2; Polypeptide P1.A; hP1.A; Protein pS2

products gene name :

TFF1

other gene names :

TFF1; TFF1; pS2; BCEI; HPS2; HP1.A; pNR-2; D21S21; BCEI; PS2; hP1.A

uniprot entry name :

TFF1_HUMAN

host :

E Coli

sequence length :

sequence :

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVR
GVPWCFYPNTIDVPPEEECEF.

purity :

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

form :

The protein was lyophilized after dialysis against 1xPBS pH-7.4. Sterile Filtered White lyophilized (freeze-dried) powder.

storage stability :

Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution TFF1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

other info2 :

Solubility: It is recommended to reconstitute the lyophilized TFF1 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1,000-2,000ng/ml corresponding to a specific activity of 500-1,000IU/mg.

products categories :

CYTOKINES AND GROWTH FACTORS; Cytokines; Trefoil Factor

products description :

Description: TFF-1 Human Recombinant produced in E Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved interamolecular disulfide bonds and having a total molecular mass of 13.2 kDa. TFF-1 Human Recombinant is purified by proprietary chromatographic techniques. Introduction: The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are stable secretory proteins expressed in the gastrointestinal tract (gastric mucosa), and are involved in intestinal mucosal defense and repair. TFF1 is an essential protein for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. TFF1 is a stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. TFF1 protects the mucosa from isults, stabilizes the mucus layer, & affects healing of the epithelium. TFF1 is commonly expressed in tumors. TFF1 is related with the cell membrane of MCF-7 cells. High levels of TFF1 and TFF2 are found in serum from inflammatory bowel disease.

ncbi gi num :

4507451

ncbi acc num :

NP_003216.1

ncbi gb acc num :

NM_003225.2

uniprot acc num :

P04155

ncbi mol weight :

9,150 Da

ncbi pathways :

FOXA1 Transcription Factor Network Pathway (137979); Integrated Pancreatic Cancer Pathway (711360)

ncbi summary :

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]

uniprot summary :

TFF1: Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 21q22.3. Cellular Component: extracellular space. Molecular Function: protein binding; growth factor activity. Biological Process: negative regulation of cell proliferation; response to peptide hormone stimulus; maintenance of gastrointestinal epithelium; carbohydrate metabolic process; digestion; cell differentiation; response to iron ion; response to estradiol stimulus

size1 :

0.005 mg

price1 :

140 USD

size2 :

0.02 mg

price2 :

205

size3 :

1 mg

price3 :

2665

more info or order :

MyBioSource product webpage