protein

Recombinant Human Thymus and Activation Regulated Chemokine (CCL17)

MBS143282

0.005 mg

140 USD

Recombinant Protein

Recombinant Human Thymus and Activation Regulated Chemokine (CCL17)

Thymus and Activation Regulated Chemokine

TARC Human; Thymus & Activation Regulated Chemokine Human Recombinant (CCL17); C-C motif chemokine 17; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; CC chemokine TARC; ABCD-2; CCL17; CCL-17; SCYA17; TARC; A-152E5.3; MGC138271; MGC138273

C-C motif chemokine 17; C-C motif chemokine 17; C-C motif chemokine 17; CC chemokine TARC; T cell-directed CC chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17; small-inducible cytokine A17; thymus and activation-regulated chemokine; chemokine (C-C motif) ligand 17; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine

TARC

CCL17; CCL17; TARC; ABCD-2; SCYA17; A-152E5.3; SCYA17; TARC

CCL17_HUMAN

E Coli

94

RVKNAVKYLQSLERS.
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAI
VFVTVQGRAICSDPNNK

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution TARC should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized CCL17 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

CHEMOKINES; Chemokines; TARC (CCL17)

Description: CCL17 Human Recombinant produced in E Coli is a single,non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 8 kDa. The TARC is purified by proprietary chromatographic techniques. Introduction: TARC cDNA encodes a 94 amino acid precursor protein with a 23 amino acid residue signal peptide that is cleaved off to generate the 71 amino acid residue mature secreted protein. Along with CC chemokine family members, CCL-17 has approximately 24-29% amino acid sequence identity with RANTES, MIP-1a, MIP-1b, MCP-1, MCP-2, MCP-3 and I-309. TARC is expressed in thymus, and at a lower level in the lung, colon, and small intestine. TARC is in addition transiently expressed in stimulated peripheral blood mononuclear cells. Recombinant TARC has been shown to be chemotactic for T cell lines but not monocytes or neutrophils. CCL-17 was recently identified to be a specific functional ligand for CCR4, a receptor that is selectively expressed on T cells. CCL17 is one of quite a few Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. CCL17 shows chemotactic activity for T lymphocytes, but not monocytes or granulocytes. CCL17 binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.

4506829

NP_002978.1

NM_002987.2

Q92583

10,507 Da

Chemokine Receptors Bind Chemokines Pathway (106359); Chemokine Signaling Pathway (99051); Chemokine Signaling Pathway (96864); Class A/1 (Rhodopsin-like Receptors) Pathway (106357); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway (1127664); Disease Pathway (530764); GPCR Ligand Binding Pathway (161020); IL4-mediated Signaling Events Pathway (137933)

This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq, Sep 2014]

CCL17: Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4. Belongs to the intercrine beta (chemokine CC) family. Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 16q13. Cellular Component: extracellular space; extracellular region. Molecular Function: CCR4 chemokine receptor binding; chemokine activity; receptor binding. Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; multicellular organismal development; immune response; negative regulation of myoblast differentiation; inflammatory response; chemotaxis

0.005 mg

140 USD

0.02 mg

205

1 mg

2665