protein

Recombinant Human Eotaxin-2 (CCL24)

MBS143273

0.02 mg

205 USD

Recombinant Protein

Recombinant Human Eotaxin-2 (CCL24)

Eotaxin-2

Eotaxin 2 Human; Eotaxin-2 Human Recombinant (CCL24); C-C motif chemokine 24; Small-inducible cytokine A24; Myeloid progenitor inhibitory factor 2; CK-beta-6; Eosinophil chemotactic protein 2; Eotaxin-2; CCL24; Ckb-6; MPIF2; MPIF-2; SCYA24; Eotaxin2; CCL-24; Eotaxin 2

C-C motif chemokine 24; C-C motif chemokine 24; C-C motif chemokine 24; CK-beta-6; eosinophil chemotactic protein 2; eotaxin-2; myeloid progenitor inhibitory factor 2; small inducible cytokine subfamily A (Cys-Cys), member 24; small-inducible cytokine A24; chemokine (C-C motif) ligand 24; CK-beta-6; Eosinophil chemotactic protein 2; Eotaxin-2; Myeloid progenitor inhibitory factor 2; MPIF-2; Small-inducible cytokine A24

CCL24; CCL24; Ckb-6; MPIF2; MPIF-2; SCYA24; MPIF2; SCYA24; MPIF-2

CCL24_HUMAN

E Coli

119

QRYMKNLDAKQKKASPRARAVA.
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIF
TTKKGQQFCGDPKQEWV

Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CCL24 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.

CHEMOKINES; Chemokines; Eotaxin

Description: CCL24 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques. Introduction: Eotaxin-2, also called MPIF2 & Ckb6, is a novel CC chemokine produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Furthermore, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which includes C-terminal truncation, contains 78 amino acids (92 amino acids for the mouse homolog, without C-terminal truncation).CCL24 functions as a chemotactic chemokine for resting t-lymphocytes, and eosinophils. CCL24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line and binds to CCR3.

22165427

NP_002982.2

NM_002991.2

O00175

13,134 Da

Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460

This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq, Jul 2008]

0.02 mg

205 USD