catalog number :
MBS143272
products type :
Recombinant Protein
products full name :
Recombinant Human LEC/NCC-4 (CCL16)
products short name :
LEC/NCC-4
products name syn :
CCL16 Human; LEC/NCC-4 Human Recombinant; C-C motif chemokine 16; Small-inducible cytokine A16; IL-10-inducible chemokine; Chemokine LEC; Monotactin-1; Chemokine CC-4; Lymphocyte and monocyte chemoattractant; CCL-16; HCC-4; HCC4; NCC4; NCC-4; Liver Expressed Chemokine; LMC; LCC-1; LCC1; MTN-1; MTN1; SCYL4; ckB12; SCYA16; LEC; ILINCK; MGC117051
other names :
C-C motif chemokine 16; C-C motif chemokine 16; C-C motif chemokine 16; IL-10-inducible chemokine; chemokine LEC; liver CC chemokine-1; liver-expressed chemokine; lymphocyte and monocyte chemoattractant; monotactin-1; new CC chemokine 4; small inducible cytokine subfamily A (Cys-Cys), member 16; small-inducible cytokine A16; chemokine (C-C motif) ligand 16; Chemokine CC-4; HCC-4; Chemokine LEC; IL-10-inducible chemokine; LCC-1; Liver-expressed chemokine; Lymphocyte and monocyte chemoattractant; LMC; Monotactin-1; MTN-1; NCC-4; Small-inducible cytokine A16
products gene name :
CCL16
other gene names :
CCL16; CCL16; LEC; LMC; NCC4; CKb12; HCC-4; LCC-1; Mtn-1; NCC-4; SCYL4; ILINCK; SCYA16; ILINCK; NCC4; SCYA16; HCC-4; LMC; MTN-1
uniprot entry name :
CCL16_HUMAN
sequence :
NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ.
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHL
PAIIFVTKRNREVCTNP
purity :
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
The CCL16 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized CCL16 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CCL16 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized CCL16in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
products categories :
CHEMOKINES; Chemokines
products description :
Description: CCL16 Human Recombinant produced in E Coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by proprietary chromatographic techniques. Introduction: Human CCL16, also called HCC-4, liver-expressed chemokine (LEC), and lymphocyte and monocyte chemoattractant (LMC), is a novel CC chemokine recognized by bioinformatics. NCC-4 cDNA encodes a 120 amino acids along with a 23 amino acids signal peptide that is cleaved to generate 97 amino acid protein. HCC4 is vaguely related to other CC chemokines, showing less than 30% sequence identity. Among CC chemokines, CCL-16 has the largest similarity to HCC-1. 2 potential polyadenylation signals are present on the human HCC-4 gene, and as a result, 2 transcripts containing roughly 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly upregulated in the presence of IL-10. CCL16 shows chemotactic activity for lymphocytes and monocytes rather than to neutrophils. NCC-4 has potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. CCL16 demonstrates chemotactic activity for monocytes and thp-1 monocytes, rather than for resting lymphocytes and neutrophils. HCC-4 induces a calcium flux in thp-1 cells that desensitized prior to the expression of rantes.
ncbi acc num :
NP_004581.1
ncbi gb acc num :
NM_004590.3
ncbi mol weight :
13,600 Da
ncbi pathways :
Chemokine Receptors Bind Chemokines Pathway 106359!!Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway 1127664!!Disease Pathway 530764!!G Alpha (i) Signalling Events Pathway 119550!!GPCR Downstream Signaling Pathway 119548
ncbi summary :
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. [provided by RefSeq, Jul 2008]