protein

Recombinant Human BCA-1/ BLC (CXCL13)

MBS143270

0.02 mg

205 USD

Recombinant Protein

Recombinant Human BCA-1/ BLC (CXCL13)

BCA-1/ BLC

BCA 1 Human; BCA-1/BLC Human Recombinant (CXCL13); C-X-C motif chemokine 13; Small-inducible cytokine B13; B lymphocyte chemoattractant; CXC chemokine BLC; CXCL13; BCA1; BCA-1; CXCL-13; B cell Attracting Chemokine-1; BLC; ANGIE; BLR1L; SCYB13; ANGIE2

C-X-C motif chemokine 13; C-X-C motif chemokine 13; C-X-C motif chemokine 13; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); B-lymphocyte chemoattractant; CXC chemokine BLC; b cell-attracting chemokine 1; b lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small-inducible cytokine B13; chemokine (C-X-C motif) ligand 13; Angie; B cell-attracting chemokine 1; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13

BCA 1

CXCL13; CXCL13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13; BCA1; BLC; SCYB13; BCA-1

CXL13_HUMAN

E Coli

109

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP.

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

The BCA-1 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution BCA1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized CXCL13 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

CHEMOKINES; Chemokines; BCA-1/ BLC

Description: CXCL13 Human Recombinant produced in E Coli is a single,non-glycosylated, polypeptide chain containing 87 amino acids and having a molecular mass of 10.3 kDa. The BCA-1 is purified by proprietary chromatographic techniques. Introduction: BCA-1 is a CXC chemokine that is highly expressed in thesecondary lymphoid organs, such as follicles of the spleen, lymph nodes, and Peyer's patches. CXCL13 promotes the migration of B lymphocytes (compared to T cells and macrophages), by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR1). BCA1 therefore function in the homing of B lymphocytes to follicles. Human BCA-1 shares a 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt's lymphoma cells, has now been shown to be the specific receptor for BCA1. Among cells of the hematopoietic lineages, the expression of BLR-1, now designated CXCR-5, is restricted to B lymphocytes and a subpopulation of T helper memory cells.

5453577

NP_006410.1

NM_006419.2

O43927

12,664 Da

CXCR3-mediated Signaling Events Pathway 138011!!Chemokine Receptors Bind Chemokines Pathway 106359!!Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway 1127664!!Disease Pathway 530764!!G Alpha (i) Signalling Events Pathway 119550

B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]

0.02 mg

205 USD