Recombinant Human Myelin Oligodendrocyte Glycoprotein | MyBioSource MBS143269 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Myelin Oligodendrocyte Glycoprotein

catalog :

MBS143269

quantity :

0.01 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS143269

products type :

Recombinant Protein

products full name :

Recombinant Human Myelin Oligodendrocyte Glycoprotein

products short name :

Myelin Oligodendrocyte Glycoprotein

products name syn :

MOG Human; Myelin Oligodendrocyte Glycoprotein Human Recombinant; Myelin Oligodendrocyte Glycoprotein; MOG; MOGIG-2; MGC26137

other names :

myelin-oligodendrocyte glycoprotein isoform alpha3; Myelin-oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; myelin oligodendrocyte glycoprotein

products gene name :

MOG

other gene names :

MOG; MOG; BTN6; BTNL11; MOGIG2; NRCLP7

uniprot entry name :

MOG_HUMAN

host :

E Coli

sequence length :

224

sequence :

MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVG
WYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIG
EGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVE
DPFYWVSPGHHHHHH.

purity :

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

form :

The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride. Sterile Filtered White lyophilized (freeze-dried) powder.

storage stability :

Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution MOG should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

app notes :

5-20ug per ml for In-Vitro Experiments and 50-100up per animal for In-Vitro study. The protein can be used for T-cell proliferation, cytokine induction, antigen presentation, Western Blotting, ELISA and EAE induction in mice.

other info2 :

Solubility: It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

products categories :

RECOMBINANT & NATURAL PROTEINS; Recombinant Proteins; Myelin Oligodendrocyte Glycoprotein

products description :

Description: Myelin Oligodendrocyte Glycoprotein produced in E Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa. Introduction: Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.

ncbi gi num :

56788389

ncbi acc num :

NP_001008229.1

ncbi gb acc num :

NM_001008228.2

uniprot acc num :

Q16653

ncbi mol weight :

33,528 Da

ncbi summary :

The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

uniprot summary :

MOG: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell- cell communication. Defects in MOG are the cause of narcolepsy type 7 (NRCLP7). Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed. Belongs to the immunoglobulin superfamily. BTN/MOG family. 10 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, multi-pass; Membrane protein, integral. Chromosomal Location of Human Ortholog: 6p22.1. Cellular Component: plasma membrane; integral to membrane. Biological Process: central nervous system development; positive regulation of MyD88-dependent toll-like receptor signaling pathway; cell adhesion. Disease: Narcolepsy 7

size1 :

0.01 mg

price1 :

140 USD

size2 :

0.05 mg

price2 :

205

size3 :

1 mg

price3 :

1500

more info or order :

MyBioSource product webpage