catalog number :
MBS143251
products type :
Recombinant Protein
products full name :
Recombinant Human High-Mobility Group Box 1
products short name :
High-Mobility Group Box 1
products name syn :
HMGB1 Human; High-Mobility Group Box 1 Human Recombinant; HMG1; HMG3; SBP-1; Amphoterin; HMGB1; High-Mobility Group Box 1
other names :
high mobility group protein B1; High mobility group protein B1; high mobility group protein B1; Amphoterin; HMG-1; Sulfoglucuronyl carbohydrate binding protein; high mobility group protein 1; high-mobility group (nonhistone chromosomal) protein 1; high-mobility group box 1; high mobility group box 1; High mobility group protein 1; HMG-1
products gene name :
HMGB1
other gene names :
HMGB1; HMGB1; HMG1; HMG3; SBP-1; HMG1; HMG-1
uniprot entry name :
HMGB1_HUMAN
sequence :
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFS
EFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTY
IPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEH
PGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYE
KDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEED
EEEEEDEEDEDEEEDDDDELEHHHHHH.
purity :
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
The HMG1 (1 mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution HMGB1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized HMGB1 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
products categories :
RECOMBINANT & NATURAL PROTEINS; Recombinant Proteins; High-Mobility Group
products description :
Description: HMG1 Human Recombinant fused with 6X His tag produced in E Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.The HMGB-1 is purified by proprietary chromatographic techniques. Introduction: High-mobility group box 1 protein (HMGB1), previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu.4, 5 Residues 27 - 43 and 178 - 184 contain a NLS. Posttranslational modifications of the molecule have been reported, with acetylation occurring on as many as 17 lysine residues. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins.
ncbi acc num :
NP_002119.1
ncbi gb acc num :
NM_002128.4
ncbi mol weight :
24,894 Da
ncbi pathways :
Activated TLR4 Signalling Pathway (106400); Activation Of DNA Fragmentation Factor Pathway (105683); Advanced Glycosylation Endproduct Receptor Signaling Pathway (187092); Apoptosis Pathway (105648); Apoptosis Induced DNA Fragmentation Pathway (105682); Apoptotic Execution Phase Pathway (105677); Base Excision Repair Pathway (83043); Base Excision Repair Pathway (451); Cytosolic Sensors Of Pathogen-associated DNA Pathway (576255); DEx/H-box Helicases Activate Type I IFN And Inflammatory Cytokines Production Pathway (833822)
uniprot summary :
HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2. Belongs to the HMGB family. Protein type: DNA repair, damage; Nuclear receptor co-regulator. Chromosomal Location of Human Ortholog: 13q12. Cellular Component: nucleoplasm; extracellular space; cell surface; transcriptional repressor complex; extracellular region; condensed chromosome; nucleus. Molecular Function: protein binding; RAGE receptor binding; double-stranded DNA binding; damaged DNA binding; cytokine activity; chromatin binding; DNA bending activity; transcription factor activity; transcription factor binding; single-stranded DNA binding; chemoattractant activity. Biological Process: negative regulation of transcriptional preinitiation complex assembly; V(D)J recombination; DNA topological change; positive regulation of apoptosis; apoptosis; positive regulation of caspase activity; base-excision repair, DNA ligation; negative regulation of transcription from RNA polymerase II promoter; DNA recombination; chromatin remodeling; regulation of transcription from RNA polymerase II promoter; myeloid dendritic cell activation; inflammatory response to antigenic stimulus; positive chemotaxis; innate immune response; DNA ligation during DNA repair; dendritic cell chemotaxis; positive regulation of transcription from RNA polymerase II promoter; DNA fragmentation during apoptosis; neurite development; positive regulation of DNA binding; cell structure disassembly during apoptosis