catalog number :
MBS143245
products type :
Recombinant Protein
products full name :
Recombinant Human Cyclin-Dependent Kinase Inhibitor 2A
products short name :
Cyclin-Dependent Kinase Inhibitor 2A
products name syn :
p16-INK4a Human; Cyclin-Dependent Kinase Inhibitor 2A Human Recombinant; Cyclin-dependent kinase 4 inhibitor A; CDK4I; p16-INK4; p16-INK4a; p16INK4A; CDKN-2A; CDKN2; Multiple tumor suppressor 1; MTS1; CMM2; MLM; TP16; p16(INK4); p19
other names :
cyclin-dependent kinase inhibitor 2A isoform p16INK4a; Cyclin-dependent kinase inhibitor 2A, isoforms 1/2/3; cyclin-dependent kinase inhibitor 2A; CDK4 inhibitor p16-INK4; CDKN2A; cell cycle negative regulator beta; cyclin-dependent kinase 4 inhibitor A; cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4); multiple tumor suppressor 1; cyclin-dependent kinase inhibitor 2A; Cyclin-dependent kinase 4 inhibitor A; CDK4I; Multiple tumor suppressor 1; MTS-1; p16-INK4a; p16-INK4; p16INK4A
products gene name :
p16-INK4a
other gene names :
CDKN2A; CDKN2A; ARF; MLM; P14; P16; P19; CMM2; INK4; MTS1; TP16; CDK4I; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A; CDKN2; MTS1; CDK4I; MTS-1; p16-INK4; p16INK4A
uniprot entry name :
CD2A1_HUMAN
sequence :
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPN
APNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATL
TRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDL
AEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
.
purity :
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
CDKN2A was lyophilized from a concentrated (1mg/ml) sterile solution containing 1x PBS pH-7.4. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Cyclin-dependent kinase although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Cyclin-dependent kinase should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized Cyclin-dependent kinase in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
products categories :
PROTEIN KINASES; Enzymes; Cyclin-Dependent Kinase
products description :
Description: CDKN2A Human Recombinant produced in E Coli, it's a single non-glycosylated polypeptide chain containing 156 amino acids, approximately 16.5 kDa.CDKN2A is purified by proprietary chromatographic techniques. Introduction: Cyclin-dependent kinase inhibitors (CDKIs) are proteins that bind to and inhibit the activity of CDKs. Two major classes of CDK inhibitors have been identified. The p16 family (p15, p16, p18 and p19) binds to and inhibits the activities of CDK4 and CDK6. The p21 family (p21, p27, p28 and p57) can bind to broad range of CDK-cyclin complexes and inhibit their activities. CDKIs are capable of suppressing growth, and several lines of evidence strongly suggest that at least some CDKIs may be tumor suppressor proteins.
ncbi acc num :
NP_000068.1
ncbi gb acc num :
NM_000077.4
ncbi mol weight :
8,731 Da
ncbi pathways :
Apoptosis Pathway (198797); Apoptosis Modulation And Signaling Pathway (198822); Bladder Cancer Pathway (83115); Bladder Cancer Pathway (527); Cell Cycle Pathway (530733); Cell Cycle, Mitotic Pathway (105765); Cell Cycle Pathway (198811); Cell Cycle Pathway (83054); Cell Cycle Pathway (463); Cellular Senescence Pathway (905991)
ncbi summary :
This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene. [provided by RefSeq, Sep 2012]
uniprot summary :
p16-INK4A: a cell-cycle regulatory protein that interacts with CDK4 and CDK6, inhibiting their ability to interact with cyclins D. Inhibits the phosphorylation of the retinoblastoma protein by CDK4 or CDK6, and entry into the S phase of the cell cycle. The p16INK4A and p14ARF proteins are encoded by CDKN2A, a known tumour suppressor gene in multiple cancers. CDKN2A is inactivated in 72% of cases of lung squamous cell carcinoma: 21% by epigenetic silencing by methylation, 18% inactivating mutation, 4% by exon 1b skipping, and 29% by homozygous deletion. Defects in CDKN2A are the cause of familial atypical multiple mole melanoma-pancreatic carcinoma syndrome, Li-Fraumeni syndrome, and the melanoma-astrocytoma syndrome. The melanoma-astrocytoma syndrome is characterized by a dual predisposition to melanoma and neural system tumors, commonly astrocytoma. Four alternatively spliced p16 isoforms have been reported. Two alternatively spliced isoforms of ARF have been reported. Protein type: Nucleolus; Cell cycle regulation; Tumor suppressor. Chromosomal Location of Human Ortholog: 9p21. Cellular Component: nucleoplasm; nuclear body; protein complex; mitochondrion; cytoplasm; nucleolus; nucleus; cytosol. Molecular Function: cyclin-dependent protein kinase inhibitor activity; NF-kappaB binding; protein binding; DNA binding; p53 binding; ubiquitin-protein ligase inhibitor activity; protein kinase binding; transcription factor binding. Biological Process: protein polyubiquitination; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; regulation of protein stability; negative regulation of B cell proliferation; regulation of protein export from nucleus; negative regulation of cell proliferation; apoptotic mitochondrial changes; regulation of G2/M transition of mitotic cell cycle; somatic stem cell division; cell cycle arrest; negative regulation of immature T cell proliferation in the thymus; caspase activation; protein destabilization; protein stabilization; transcription, DNA-dependent; negative regulation of cyclin-dependent protein kinase activity; negative regulation of cell-matrix adhesion; positive regulation of protein sumoylation; inhibition of NF-kappaB transcription factor; Ras protein signal transduction; negative regulation of ubiquitin-protein ligase activity; negative regulation of phosphorylation; negative regulation of protein kinase activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of DNA damage response, signal transduction by p53 class mediator; mitotic cell cycle; negative regulation of cell growth; negative regulation of transcription, DNA-dependent; rRNA processing; G1/S transition of mitotic cell cycle. Disease: Melanoma-astrocytoma Syndrome; Melanoma, Cutaneous Malignant, Susceptibility To, 2; Melanoma-pancreatic Cancer Syndrome