product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Pramlintide
catalog :
MBS143226
quantity :
1 mg
price :
140 USD
more info or order :
product information
catalog number :
MBS143226
products type :
Native Protein
products full name :
Pramlintide
products short name :
Pramlintide
products name syn :
Pramlintide; Pramlintide; Pramlintide
sequence :
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.
purity :
Greater than 98.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
The protein was lyophilized with no additives. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Pramlintide should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized Pramlintide in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.
products categories :
HORMONES; Hormones; Peptide Hormones
products description :
Description: Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2. Introduction: Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.
size1 :
1 mg
price1 :
140 USD
size2 :
5 mg
price2 :
205
size3 :
25 mg
price3 :
550
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!