Recombinant Human Paraoxonase-1 | MyBioSource MBS143199 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Paraoxonase-1

catalog :

MBS143199

quantity :

0.002 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS143199

products type :

Recombinant Protein

products full name :

Recombinant Human Paraoxonase-1

products short name :

Paraoxonase-1

products name syn :

PON1 Human; Paraoxonase-1 Human Recombinant; Serum paraoxonase; arylesterase 1; EC 3.1.1.2; EC 3.1.8.1; PON 1; Serum aryldialkylphosphatase 1; A-esterase 1; Aromatic esterase 1; K-45; ESA; PON

other names :

serum paraoxonase/arylesterase 1; Serum paraoxonase/arylesterase 1; serum paraoxonase/arylesterase 1; A-esterase 1; K-45; PON 1; aromatic esterase 1; arylesterase B-type; esterase A; paraoxonase B-type; serum aryldiakylphosphatase; serum aryldialkylphosphatase 1; paraoxonase 1; Aromatic esterase 1; A-esterase 1; K-45; Serum aryldialkylphosphatase 1

products gene name :

PON1

other gene names :

PON1; PON1; ESA; PON; MVCD5; PON; PON 1; A-esterase 1

uniprot entry name :

PON1_HUMAN

host :

E Coli

sequence length :

355

sequence :

MAKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVEL
PNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGIKSFN
PNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGI
STFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHL
KTIRHKLLPNLNDIVAVGPEHFYGTNDHYFLDPYLRSWE
MYLGLAWSYVVYYSPSEVRVVAEGFDFANGINISPDGKY
VYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISV
DPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILT
EEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKAL
YCELZ.

purity :

Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.

form :

PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol. Sterile Filtered clear solution.

storage stability :

Store at 4 degree C if entire vial will be used within 1-2 weeks. Store, frozen at -20 degree C for longer periods of time. Avoid multiple freeze-thaw cycles.

tested application :

Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)

app notes :

Arylesterase 1 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested.

products categories :

ENZYMES; Enzymes; Paraoxonase

products description :

Description: Paraoxonase-1 Isoform Human Recombinant is expressed in E Coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag.The PON1 purified by proprietary chromatographic techniques. Introduction: Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs).

ncbi gi num :

19923106

ncbi acc num :

NP_000437.3

ncbi gb acc num :

NM_000446.5

uniprot acc num :

P27169

ncbi mol weight :

39,731 Da

ncbi pathways :

Metabolic Pathways (132956); Phase I, Non P450 Pathway (198854)

ncbi summary :

The enzyme encoded by this gene is an arylesterase that mainly hydrolyzes paroxon to produce p-nitrophenol. Paroxon is an organophosphorus anticholinesterase compound that is produced in vivo by oxidation of the insecticide parathion. Polymorphisms in this gene are a risk factor in coronary artery disease. The gene is found in a cluster of three related paraoxonase genes at 7q21.3. [provided by RefSeq, Oct 2008]

uniprot summary :

PON1: Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. Genetic variation in PON1 is associated with susceptibility to microvascular complications of diabetes type 5 (MVCD5). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new- onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Homozygosity for the Leu-54 allele is strongly associated with the development of retinal disease in diabetic patients. Belongs to the paraoxonase family. Protein type: EC 3.1.1.2; Secreted; Lipid-binding; EC 3.1.1.81; Secreted, signal peptide; Motility/polarity/chemotaxis; Phosphatase (non-protein); Hydrolase; EC 3.1.8.1. Chromosomal Location of Human Ortholog: 7q21.3. Cellular Component: extracellular space; intracellular membrane-bound organelle; extracellular region. Molecular Function: protein homodimerization activity; arylesterase activity; phospholipid binding; calcium ion binding; aryldialkylphosphatase activity. Biological Process: response to nutrient levels; response to external stimulus; dephosphorylation; response to toxin; organophosphate catabolic process; positive regulation of transporter activity; carboxylic acid catabolic process; positive regulation of binding; aromatic compound catabolic process; phosphatidylcholine metabolic process. Disease: Microvascular Complications Of Diabetes, Susceptibility To, 5

size1 :

0.002 mg

price1 :

140 USD

size2 :

0.01 mg

price2 :

205

size3 :

1 mg

price3 :

4960

more info or order :

MyBioSource product webpage