protein

Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus

MBS143181

1 mg

1790 USD

Recombinant Protein

Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus

Macrophage Migration Inhibitor Factor C-Terminus

MIF Human His C; Macrophage Migration Inhibitory Factor Human Recombinant, His Tag C-Terminus; Phenylpyruvate tautomerase; Glycosylation-inhibiting factor; GIF; MMIF; MIF; MIF His C

macrophage migration inhibitory factor; Macrophage migration inhibitory factor; macrophage migration inhibitory factor; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; macrophage migration inhibitory factor (glycosylation-inhibiting factor); Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase (EC:5.3.3.12); Phenylpyruvate tautomerase

MIF

MIF; MIF; GIF; GLIF; MMIF; GLIF; MMIF; MIF; GIF

MIF_HUMAN

E Coli

115

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIA
VHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSK
LLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALE
HHHHHH.

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4. Sterile Filtered lyophilized powder.

Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution MIF should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized MIF in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Measured by its ability to bind rhCD74 in a functional ELISA.

CYTOKINES AND GROWTH FACTORS; Growth Factors; Macrophage Migration Inhibitory Factor

Description: MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E Coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa. Introduction: The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

4505185

NP_002406.1

NM_002415.1

P14174

12,476 Da

Adipogenesis Pathway 198832!!Phenylalanine Metabolism Pathway 82960!!Phenylalanine Metabolism Pathway 327!!Spinal Cord Injury Pathway 739007!!Tyrosine Metabolism Pathway 82959!!Tyrosine Metabolism Pathway 325

This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]

1 mg

1790 USD