Recombinant Human Vascular Endothelial Growth Inhibitor | MyBioSource MBS143177 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Vascular Endothelial Growth Inhibitor

catalog :

MBS143177

quantity :

0.005 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS143177

products type :

Recombinant Protein

products full name :

Recombinant Human Vascular Endothelial Growth Inhibitor

products short name :

Vascular Endothelial Growth Inhibitor

products name syn :

VEGI Human; Human Vascular Endothelial Growth Inhibitor Recombinant; Tumor necrosis factor ligand superfamily member 15; TNFSF-15; TNFSF15; TNF ligand-related molecule 1; VEGI; TL-1; TL1; TL1A; VEGI192A; VEGI-192; MGC129934; MGC129935

other names :

tumor necrosis factor ligand superfamily member 15 isoform VEGI-192; Tumor necrosis factor ligand superfamily member 15; tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; TNF superfamily ligand TL1A; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor-192A; tumor necrosis factor (ligand) superfamily, member 15; TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitorCleaved into the following 2 chains:Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily member 15, secreted form

products gene name :

VEGI

other gene names :

TNFSF15; TNFSF15; TL1; TL1A; VEGI; VEGI192A; TL1; VEGI

uniprot entry name :

TNF15_HUMAN

host :

E Coli

sequence length :

192

sequence :

MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAH
LTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNK
FLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDS
ITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLG
AMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL.

purity :

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

form :

The TNFSF15 was lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20. Sterile Filtered White lyophilized (freeze-dried) powder.

storage stability :

TNFSF15 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution VEGI should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

other info2 :

Solubility: It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0x104 IU/mg.

products categories :

CYTOKINES AND GROWTH FACTORS; Growth Factors; VEGF

products description :

Description: TNFSF15 Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a molecular mass of 20.5kDa. The TNFSF15 is purified by proprietary chromatographic techniques. Introduction: TNFSF15 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of TNFSF15 is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. TNFSF15 is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined.

ncbi gi num :

324072728

ncbi acc num :

NP_001191273.1

ncbi gb acc num :

NM_001204344.1

uniprot acc num :

O95150

ncbi mol weight :

20,131 Da

ncbi pathways :

Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Senescence And Autophagy Pathway (198780)

ncbi summary :

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]

uniprot summary :

TNFSF15: Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Cytokine; Apoptosis. Chromosomal Location of Human Ortholog: 9q32. Cellular Component: extracellular space; integral to plasma membrane; plasma membrane; integral to membrane. Molecular Function: death receptor binding; cytokine activity; tumor necrosis factor receptor binding; receptor binding. Biological Process: caspase activation; cytokine metabolic process; activation of NF-kappaB-inducing kinase; immune response; signal transduction; positive regulation of cytokine secretion

size1 :

0.005 mg

price1 :

140 USD

size2 :

0.02 mg

price2 :

205

size3 :

1 mg

price3 :

2665

more info or order :

MyBioSource product webpage