protein

Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1

MBS143122

0.01 mg

140 USD

Recombinant Protein

Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1

Ras-Related C3 Botulinum Toxin substrate 1

RAC1 Human; Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant; P21-RAC1; RAC-1; RAC1; RAS-like protein TC25; MIG5; Cell-migration-inducing gene 5 protein; Ras-related C3 botulinum toxin substrate 1; rho family small GTP binding protein Rac1; TC-25; MGC111543

ras-related C3 botulinum toxin substrate 1 isoform Rac1; Ras-related C3 botulinum toxin substrate 1; ras-related C3 botulinum toxin substrate 1; cell migration-inducing gene 5 protein; ras-like protein TC25; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); Cell migration-inducing gene 5 protein; Ras-like protein TC25; p21-Rac1

RAC1

RAC1; RAC1; MIG5; Rac-1; TC-25; p21-Rac1; TC25

RAC1_HUMAN

E Coli

192

PPVKKRKRKCLLL.
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDN
YSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFL
ICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLD
LRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLEC
SALTQRGLKTVFDEAIRAVLCP

Greater than 95.0% as determined by SDS-PAGE.

The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT. Sterile Filtered colorless solution.

RECOMBINANT & NATURAL PROTEINS; Recombinant Proteins; Ras-Related C3 Botulinum Toxin Substrate

Description: Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa. Introduction: RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion.

9845511

NP_008839.2

NM_006908.4

P63000

23,467 Da

AGE/RAGE Pathway (698754); Activation Of Rac Pathway (119530); Adaptive Immune System Pathway (366160); Adherens Junction Pathway (83070); Adherens Junction Pathway (481); Alpha6-Beta4 Integrin Signaling Pathway (198807); Amyotrophic Lateral Sclerosis (ALS) Pathway (920975); Amyotrophic Lateral Sclerosis (ALS) Pathway (83099); Amyotrophic Lateral Sclerosis (ALS) Pathway (511); Androgen Receptor Signaling Pathway (198806)

The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

RAC1: a plasma membrane-associated member of the Rho-GTPase family. Plays a key role in cytoskeletal reorganization, membrane trafficking, transcriptional regulation and cell growth and development. GTP binding stimulates its activity. Phosphorylation by Akt may inhibit GTP binding of Rac1, therefore attenuating the downstream signal transduction pathway. Found in a trimeric complex composed of DOCK1 and ELMO1, which plays a central role in phagocytosis of apoptotic cells. Two alternatively spliced isoforms have been described. Protein type: G protein; G protein, monomeric; Motility/polarity/chemotaxis; G protein, monomeric, Rho. Chromosomal Location of Human Ortholog: 7p22. Cellular Component: extrinsic to plasma membrane; Golgi membrane; focal adhesion; membrane; lamellipodium; cytoplasm; plasma membrane; melanosome; actin filament; trans-Golgi network; cytosol; phagocytic cup. Molecular Function: GTPase activity; protein binding; enzyme binding; GTP binding; GTP-dependent protein binding; thioesterase binding; Rho GDP-dissociation inhibitor binding; protein kinase binding; Rab GTPase binding. Biological Process: viral reproduction; nerve growth factor receptor signaling pathway; metabolic process; positive regulation of apoptosis; cell motility involved in cell locomotion; regulation of cell migration; small GTPase mediated signal transduction; positive regulation of stress fiber formation; cell adhesion; bone resorption; platelet activation; anatomical structure morphogenesis; mast cell chemotaxis; dendrite morphogenesis; positive regulation of Rho protein signal transduction; regulation of defense response to virus by virus; negative regulation of interleukin-23 production; T cell costimulation; cerebral cortex radially oriented cell migration; actin cytoskeleton organization and biogenesis; axon guidance; cell-matrix adhesion; localization within membrane; positive regulation of focal adhesion formation; actin filament polymerization; response to wounding; ephrin receptor signaling pathway; inflammatory response; regulation of hydrogen peroxide metabolic process; lamellipodium biogenesis; intercellular junction assembly and maintenance; embryonic olfactory bulb interneuron precursor migration; Wnt receptor signaling pathway, planar cell polarity pathway; positive regulation of phosphoinositide 3-kinase activity; engulfment of apoptotic cell; G-protein coupled receptor protein signaling pathway; cell proliferation; hyperosmotic response; positive regulation of actin filament polymerization; organization of an anatomical structure; auditory receptor cell morphogenesis; ruffle organization and biogenesis; innate immune response; negative regulation of receptor-mediated endocytosis; positive regulation of protein amino acid phosphorylation; cell motility; vascular endothelial growth factor receptor signaling pathway; blood coagulation; positive regulation of DNA replication

0.01 mg

140 USD

0.05 mg

205

1 mg

1790