catalog number :
MBS1431009
products type :
Recombinant Protein
products full name :
Recombinant Mouse Endothelial cell-specific molecule 1
products short name :
[Endothelial cell-specific molecule 1]
products name syn :
[ESM-1]
other names :
[endothelial cell-specific molecule 1; Endothelial cell-specific molecule 1; endothelial cell-specific molecule 1; endothelial cell-specific molecule 1]
products gene name :
[Esm1]
other gene names :
[Esm1; Esm1; ESM-1; AV004503; 0610042H23Rik; ESM-1]
uniprot entry name :
ESM1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[22-184aa; Full Length]
sequence :
AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAG
PGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGIC
KDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYA
AAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSV
MKWLNPR
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Species: Mus musculus (Mouse)
products categories :
Tags & Cell Markers
products description :
Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions
products references :
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004)
ncbi acc num :
NP_076101.1
ncbi gb acc num :
NM_023612.3
ncbi mol weight :
33.71kD
uniprot summary :
ESM1: May have potent implications in lung endothelial cell- leukocyte interactions. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted, signal peptide; Secreted. Cellular Component: extracellular region. Molecular Function: hepatocyte growth factor receptor binding; insulin-like growth factor binding; integrin binding. Biological Process: angiogenesis; positive regulation of cell proliferation; regulation of cell growth; sprouting angiogenesis