product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Protein G
catalog :
MBS142957
quantity :
1 mg
price :
140 USD
more info or order :
product information
catalog number :
MBS142957
products type :
Recombinant Protein
products full name :
Recombinant Protein G
products short name :
Protein G
products name syn :
Protein G; Protein G Recombinant; Protein-G
other names :
protein G; Protein G; Protein G
uniprot entry name :
C3V8X8_BPPHX
host :
E Coli
sequence length :
175
sequence :
KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGV
DGEWTYDDAT
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGV
DGEWTYDDAT
specificity :
1. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a. 2. Does not bind to human IgM, IgD and IgA.
purity :
>95% as determined by SDS-PAGE and RP-HPLC.
form :
Lyophilized white powder containing no additives. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Protein G should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.
other info2 :
Reconstitution: Reconstitution with deionized water or PBS.
products categories :
RECOMBINANT & NATURAL PROTEINS; Recombinant Proteins; Protein-A, A/G & G
products description :
Description: Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains 196 amino acids (190-384) having a molecular mass of 21.6 kDa. The Protein-G migrates on SDS-PAGE around 32 kDa.
ncbi gi num :
288872858
ncbi acc num :
ADC55536.1
ncbi mol weight :
19,047 Da
size1 :
1 mg
price1 :
140 USD
size2 :
10 mg
price2 :
205
size3 :
100 mg
price3 :
550
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!