product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human MHC class I chain-related gene A
catalog :
MBS142922
quantity :
0.002 mg
price :
140 USD
more info or order :
product information
catalog number :
MBS142922
products type :
Recombinant Protein
products full name :
Recombinant Human MHC class I chain-related gene A
products short name :
MHC class I chain-related gene A
products name syn :
MICA Human; MHC Class-I chain related gene A Human Recombinant; MHC class I polypeptide-related sequence A; MIC-A; MICA; PERB11.1; HLA-B; AS; HLAB; HLAC; SPDA1; HLA-B73; HLA-B-7301
other names :
MHC class I polypeptide-related sequence A isoform 1 (MICA*001); MHC class I polypeptide-related sequence A; MHC class I polypeptide-related sequence A; HLA class I antigen; MHC class I chain-related protein A; MICA; stress inducible class I homolog; MHC class I polypeptide-related sequence A
products gene name :
MICA
other gene names :
MICA; MICA; MIC-A; PERB11.1; MIC-A
uniprot entry name :
MICA_HUMAN
host :
E Coli
sequence length :
383
sequence :
EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQ
KCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLA
HIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELF
LSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTH
YHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASE
GNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVL
PDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVP
SGKVLVLQSH.
purity :
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
Lyophilized from a concentrated (1mg/ml) solution containing no additives. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution MICA should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized MICA in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Measured by its ability to bind MICA antibody in ELISA.
products categories :
RECOMBINANT & NATURAL PROTEINS; Recombinant Proteins; MHC class I chain-related gene
products description :
Description: MICA Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 Gln308) The MICA is purified by proprietary chromatographic techniques. Introduction: MICA (MHC class I chain-related gene A) is a transmembrane glycoprotein that functions as a ligand for human NKG2D. A closely related protein, MICB, shares 85% amino acid identity with MICA. These proteins are distantly related to the MHC class I proteins. They possess three extracellular Ig-like domains, but they have no capacity to bind peptide or interact with ?2-microglobulin. The genes encoding these proteins are found within the Major Histocompatibility Complex on human chromosome 6. The MICA locus is highly polymorphic with more than 50 recognized human alleles. MICA is absent from most cells but is frequently expressed in epithelial tumors and can be induced by bacterial and viral infections. MICA is a ligand for human NKG2D, an activating receptor expressed on NK cells, NKT cells, gamma delta T cells, and CD8+ beta T cells. Recognition of MICA by NKG2D results in the activation of cytolytic activity and/or cytokine production by these effector cells. MICA recognition is involved in tumor surveillance, viral infections, and autoimmune diseases.
ncbi gi num :
4557751
ncbi acc num :
NP_000238.1
ncbi gb acc num :
NM_000247.2
uniprot acc num :
Q29983
ncbi mol weight :
31,577 Da
ncbi pathways :
Adaptive Immune System Pathway (366160); Allograft Rejection Pathway (920963); Immune System Pathway (106386); Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway (106413); Natural Killer Cell Mediated Cytotoxicity Pathway (83079); Natural Killer Cell Mediated Cytotoxicity Pathway (490)
ncbi summary :
This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2014]
uniprot summary :
MICA: Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T- cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. Anti-MICA antibodies and ligand shedding are involved in the progression of monoclonal gammopathy of undetermined significance (MGUS)to multiple myeloma. Genetic variations in MICA may be a cause of susceptibility to psoriasis type 1 (PSORS1). Psoriasis is a common, chronic inflammatory disease of the skin with multifactorial etiology. It is characterized by red, scaly plaques usually found on the scalp, elbows and knees. These lesions are caused by abnormal keratinocyte proliferation and infiltration of inflammatory cells into the dermis and epidermis. Genetic variation in MICA is a cause of susceptibility to psoriatic arthritis (PSORAS). PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis). Belongs to the MHC class I family. MIC subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 6p21.33. Cellular Component: extracellular space; cell surface; integral to plasma membrane; cytoplasm. Molecular Function: protein binding; beta-2-microglobulin binding; antigen binding; natural killer cell lectin-like receptor binding. Biological Process: antigen processing and presentation; viral reproduction; natural killer cell mediated cytotoxicity; response to heat; cytolysis; defense response to bacterium; immune response to tumor cell; gamma-delta T cell activation; defense response to virus; response to DNA damage stimulus; T cell mediated cytotoxicity. Disease: Psoriatic Arthritis, Susceptibility To; Psoriasis 1, Susceptibility To
size1 :
0.002 mg
price1 :
140 USD
size2 :
0.01 mg
price2 :
205
size3 :
1 mg
price3 :
3995
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!