Recombinant Human Cardiac Troponin-I | MyBioSource MBS142879 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Cardiac Troponin-I

catalog :

MBS142879

quantity :

0.01 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS142879

products type :

Recombinant Protein

products full name :

Recombinant Human Cardiac Troponin-I

products short name :

Cardiac Troponin-I

products name syn :

TNI Human; Cardiac Troponin I Human Recombinant; Troponin I cardiac muscle; Cardiac troponin I; TNNI3; TNNC1; CMH7; RCM1; cTnI; CMD2A; MGC116817; Troponin-I

other names :

troponin I, cardiac muscle; Troponin I, cardiac muscle; troponin I, cardiac muscle; cardiomyopathy, dilated 2A (autosomal recessive); troponin I type 3 (cardiac); Cardiac troponin I

other gene names :

TNNI3; TNNI3; CMH7; RCM1; cTnI; CMD2A; TNNC1; CMD1FF; TNNC1

uniprot entry name :

TNNI3_HUMAN

host :

E Coli

sequence length :

210

sequence :

MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKS
KISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALST
RCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAK
VTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQ
ALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI
DALSGMEGRKKKFES.

purity :

Greater than 98.0% as determined by both:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

form :

TNI solution containing 6M Urea 50mM Tris PH 8. Sterile Filtered colorless liquid formulation.

storage stability :

Store at 4 degree C if entire vial will be used within 2-4 weeks. Store, frozen at -20 degree C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

other info2 :

Protein Content: Protein quantitation was carried out by using 0.25 - 5.0 mg/ml Bradford assay vs. BSA.

products categories :

RECOMBINANT & NATURAL PROTEINS; Recombinant Proteins; Cardiac Troponin

products description :

Description: Recombinant Human TNI produced in E Coli is a single, non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 24,016 Dalton.The TNI is purified by proprietary chromatographic techniques. Introduction: Troponin I (TnI), troponin T (TnT) and troponin C (TnC) form the troponin complex of the thin filaments of striated muscle. TnI is acts as the inhibitory subunit by blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains 3 genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. The TNNI3 gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in the TNNI3 gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM).

ncbi gi num :

151101270

ncbi acc num :

NP_000354.4

ncbi gb acc num :

NM_000363.4

uniprot acc num :

P19429

ncbi mol weight :

24,008 Da

ncbi pathways :

Adrenergic Signaling In Cardiomyocytes Pathway (908257); Adrenergic Signaling In Cardiomyocytes Pathway (909696); Cardiac Progenitor Differentiation Pathway (712094); Cardiac Muscle Contraction Pathway (93344); Cardiac Muscle Contraction Pathway (93992); Dilated Cardiomyopathy Pathway (121494); Dilated Cardiomyopathy Pathway (121285); Hypertrophic Cardiomyopathy (HCM) Pathway (114229); Hypertrophic Cardiomyopathy (HCM) Pathway (106591); Muscle Contraction Pathway (106261)

ncbi summary :

Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). [provided by RefSeq, Jul 2008]

uniprot summary :

TNNI3: Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Binds to actin and tropomyosin. Interacts with TRIM63. Interacts with STK4/MST1. Belongs to the troponin I family. Protein type: Actin-binding; Motility/polarity/chemotaxis; Motor. Chromosomal Location of Human Ortholog: 19q13.4. Cellular Component: sarcomere; troponin complex; cytosol. Molecular Function: troponin T binding; protein domain specific binding; troponin C binding; protein binding; metal ion binding; calcium channel inhibitor activity; actin binding; calcium-dependent protein binding; protein kinase binding. Biological Process: cellular calcium ion homeostasis; regulation of smooth muscle contraction; heart contraction; heart development; regulation of systemic arterial blood pressure by ischemic conditions; ventricular cardiac muscle morphogenesis; vasculogenesis; negative regulation of ATPase activity; muscle filament sliding; cardiac muscle contraction. Disease: Cardiomyopathy, Dilated, 1ff; Cardiomyopathy, Familial Restrictive, 1; Cardiomyopathy, Familial Hypertrophic, 7; Cardiomyopathy, Dilated, 2a

size1 :

0.01 mg

price1 :

140 USD

size2 :

0.05 mg

price2 :

205

size3 :

1 mg

price3 :

1365

more info or order :

MyBioSource product webpage